PDB entry 3a0t

View 3a0t on RCSB PDB site
Description: Catalytic domain of histidine kinase ThkA (TM1359) in complex with ADP and Mg ion (trigonal)
Deposited on 2009-03-24, released 2009-10-20
The last revision was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.186
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensor protein
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1359
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X180 (1-151)
      • expression tag (0)
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3a0tA (A:)
meftefnlnelirevyvlfeekirkmnidfcfetdnedlrveadrtrikqvlinlvqnai
eatgengkikitsedmytkvrvsvwnsgppipeelkekifspffttktqgtglglsicrk
iiedehggkiwtenrengvvfifeipktpekr