PDB entry 3a0j

View 3a0j on RCSB PDB site
Description: Crystal structure of cold shock protein 1 from Thermus thermophilus HB8
Class: Transcription
Keywords: OB-fold, Cytoplasm, Transcription, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2009-03-19, released 2010-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-23, with a file datestamp of 2010-03-19.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.165
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cold shock protein
  Species: Thermus thermophilus [TaxId:300852]
  Gene: TTHA0175
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SLW8 (0-72)
  Domains in SCOPe 2.07: d3a0ja_
• Chain 'B':
  Compound: Cold shock protein
  Species: Thermus thermophilus [TaxId:300852]
  Gene: TTHA0175
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SLW8 (0-72)
  Domains in SCOPe 2.07: d3a0jb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3a0jA (A:)
  mqkgrvkwfnaekgygfieregdtdvfvhytainakgfrtlnegdivtfdvepgrngkgp
  qavnvtvveparr
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3a0jB (B:)
  mqkgrvkwfnaekgygfieregdtdvfvhytainakgfrtlnegdivtfdvepgrngkgp
  qavnvtvveparr