PDB entry 3a0e

View 3a0e on RCSB PDB site
Description: Crystal Structure of Polygonatum cyrtonema lectin (PCL) complexed with dimannoside
Class: sugar binding protein
Keywords: beta-prism II, Lectin, SUGAR BINDING PROTEIN
Deposited on 2009-03-16, released 2010-03-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Mannose/sialic acid-binding lectin
  Species: Polygonatum cyrtonema [TaxId:195526]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8L568 (0-109)
    • see remark 999 (26)
  Domains in SCOPe 2.08: d3a0ea_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3a0eA (A:)
  vnslsspnslftghslevgpsyrlimqgdcnfvlydsgkpvwasntgglgsgcrltlhnn
  gnlviydqsnrviwqtktngkedhyvlvlqqdrnvviygpvvwatgsgpa