PDB entry 3a0d

View 3a0d on RCSB PDB site
Description: Crystal Structure of Polygonatum cyrtonema lectin (PCL) complexed with monomannoside
Class: sugar binding protein
Keywords: beta-prism II, Lectin, SUGAR BINDING PROTEIN
Deposited on 2009-03-16, released 2010-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mannose/sialic acid-binding lectin
    Species: Polygonatum cyrtonema [TaxId:195526]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8L568 (0-109)
      • see remark 999 (26)
    Domains in SCOPe 2.07: d3a0da_
  • Heterogens: MMA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3a0dA (A:)
    vnslsspnslftghslevgpsyrlimqgdcnfvlydsgkpvwasntgglgsgcrltlhnn
    gnlviydqsnrviwqtktngkedhyvlvlqqdrnvviygpvvwatgsgpa