PDB entry 3a07

View 3a07 on RCSB PDB site
Description: crystal structure of actinohivin; potent anti-hiv protein
Deposited on 2009-03-04, released 2009-08-25
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.19 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actinohivin
    Species: actinomycete [TaxId:237531]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Actinohivin
    Species: actinomycete [TaxId:237531]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3a07A (A:)
saqfasvtirnaqtgrlldsnyngnvytlpanggnyqrwtgpgdgtvrnaqtgrcldsny
dgavytlpcnggsyqkwlfysngyiqnvetgrvldsnyngnvytlpanggnyqkwytg

    Sequence, based on observed residues (ATOM records):
    >3a07A (A:)
qfasvtirnaqtgrlldsnyngnvytlpanggnyqrwtgpgdgtvrnaqtgrcldsnydg
avytlpcnggsyqkwlfysngyiqnvetgrvldsnyngnvytlpanggnyqkwytg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3a07B (B:)
saqfasvtirnaqtgrlldsnyngnvytlpanggnyqrwtgpgdgtvrnaqtgrcldsny
dgavytlpcnggsyqkwlfysngyiqnvetgrvldsnyngnvytlpanggnyqkwytg