PDB entry 3a04

View 3a04 on RCSB PDB site
Description: Crystal structure of tryptophanyl-tRNA synthetase from hyperthermophilic archaeon, Aeropyrum pernix K1
Class: ligase
Keywords: TRYPTOPHANYL-TRNA SYNTHETASE, LIGASE, Aminoacyl-tRNA synthetase, ATP-binding, Cytoplasm, Nucleotide-binding, Protein biosynthesis
Deposited on 2009-03-02, released 2010-03-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-03-09, with a file datestamp of 2010-03-05.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.18
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophanyl-tRNA synthetase
    Species: Aeropyrum pernix [TaxId:56636]
    Gene: trpS, APE_2461.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3a04a_
  • Heterogens: SF4, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a04A (A:)
    maaerldpwgaveikdydrllrtfgirpfsevlpllrkagmepsflmrrgiifghrdfdk
    ileakargervavltgfmpsgkfhfghkltvdqliylqkngfkvfvaiadaeafavrrig
    reeavriaveeyianmialgldpkdtefyfqtnrgtpyfrliqlfsgkvtaaemeaiyge
    ltpakmmasltqaadilhvqldeyggyrhvvvpvgadqdphlrltrdladrmagvveler
    pastyhklqpgldgrkmsssrpdstifltdppevarnklfraltggrataeeqrrlggvp
    evcsvyhmdlyhlmpddgevkhiytscrlgkilcgeckqiaweklerflaehqsrlekak
    tiawklvepprf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a04A (A:)
    ldpwgaveikdydrllrtfgirpfsevlpllrkagmepsflmrrgiifghrdfdkileak
    argervavltgfmpsgkfhfghkltvdqliylqkngfkvfvaiadaeafavrrigreeav
    riaveeyianmialgldpkdtefyfqtnrgtpyfrliqlfsgkvtaaemeaiygeltpak
    mmasltqaadilhvqldeyggyrhvvvpvgadqdphlrltrdladrmagvvelerpasty
    hklqpgldgrkmsssrpdstifltdppevarnklfraltggrataeeqrrlggvpevcsv
    yhmdlyhlmpddgevkhiytscrlgkilcgeckqiaweklerflaehqsrlekaktiawk
    lvepprf