PDB entry 3a03

View 3a03 on RCSB PDB site
Description: Crystal structure of Hox11L1 homeodomain
Class: Gene Regulation
Keywords: HOMEODOMAIN, Developmental protein, DNA-binding, Homeobox, Nucleus, Gene Regulation
Deposited on 2009-02-28, released 2010-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.201
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell leukemia homeobox protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TLX2, HOX11L1, NCX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3a03a_
  • Heterogens: NA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a03A (A:)
    mtsfsrsqvlelerrflrqkylasaeraalakalrmtdaqvktwfqnrrtkwrrqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a03A (A:)
    fsrsqvlelerrflrqkylasaeraalakalrmtdaqvktwfqnrrtkwrrqt