PDB entry 3a02

View 3a02 on RCSB PDB site
Description: Crystal structure of Aristaless homeodomain
Class: Gene Regulation
Keywords: HOMEODOMAIN, Developmental protein, DNA-binding, Homeobox, Nucleus, Gene Regulation
Deposited on 2009-02-28, released 2010-03-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.173
AEROSPACI score: 1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeobox protein aristaless
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: al, CG3935
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3a02a_
  • Heterogens: CD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3a02A (A:)
gshmtftsfqleelekafsrthypdvftreelamkiglteariqvwfqnrrakwrkqekv

    Sequence, based on observed residues (ATOM records): (download) 
    >3a02A (A:)
tftsfqleelekafsrthypdvftreelamkiglteariqvwfqnrrakwr