SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.
You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 3W1K

View 3W1K on RCSB PDB site
Description: Crystal structure of the selenocysteine synthase SelA and tRNASec complex
Deposited on 2012-11-15, released 2013-06-05
The last revision was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 7.5 Å
R-factor: 0.194
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-seryl-tRNA(Sec) selenium transferase
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: selA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67140 (0-451)
      • engineered mutation (18)
      • engineered mutation (20)
      • engineered mutation (45)
      • engineered mutation (47)
  • Chain 'B':
    Compound: L-seryl-tRNA(Sec) selenium transferase
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: selA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67140 (0-451)
      • engineered mutation (18)
      • engineered mutation (20)
      • engineered mutation (45)
      • engineered mutation (47)
  • Chain 'C':
    Compound: L-seryl-tRNA(Sec) selenium transferase
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: selA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67140 (0-451)
      • engineered mutation (18)
      • engineered mutation (20)
      • engineered mutation (45)
      • engineered mutation (47)
  • Chain 'D':
    Compound: L-seryl-tRNA(Sec) selenium transferase
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: selA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67140 (0-451)
      • engineered mutation (18)
      • engineered mutation (20)
      • engineered mutation (45)
      • engineered mutation (47)
  • Chain 'E':
    Compound: L-seryl-tRNA(Sec) selenium transferase
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: selA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67140 (0-451)
      • engineered mutation (18)
      • engineered mutation (20)
      • engineered mutation (45)
      • engineered mutation (47)
  • Chain 'F':
    Compound: selenocysteine tRNA
    Species: Thermoanaerobacter tengcongensis MB4, synthetic [TaxId:273068]
  • Chain 'G':
    Compound: selenocysteine tRNA
    Species: Thermoanaerobacter tengcongensis MB4, synthetic [TaxId:273068]
  • Chain 'H':
    Compound: selenocysteine tRNA
    Species: Thermoanaerobacter tengcongensis MB4, synthetic [TaxId:273068]
  • Chain 'I':
    Compound: selenocysteine tRNA
    Species: Thermoanaerobacter tengcongensis MB4, synthetic [TaxId:273068]
  • Chain 'J':
    Compound: selenocysteine tRNA
    Species: Thermoanaerobacter tengcongensis MB4, synthetic [TaxId:273068]

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3w1kA (A:)
    mksllrqipqiskvveifakaypeiyvvkaarevaekyrkeiiegaradlngfledverk
    ikslmkpnikrvinatgvvintnlgraplskdvinfiseiangysnleynleegkrgsri
    ahiekylneltgaessfvvnnnagavflvlntlaegkeviisrgelveiggsfripdimk
    ksgailrevgttnktkvsdyegainqntallmkvhksnfymegfveevkledlvklghky
    giptyydagsgllinlkefgisvdepnfrdcislgidlvsgsgdkllggpqagiivgkkn
    liekikknpiaralridkltlsglemtlklyfekryedipvirmltqdekalrqkakrle
    kllkdipglkisvikdkakpgggslpelelptycvairhdrlssqelsrrlrlaeppivc
    riredqllfdmrtvfhedlktikktlqellsi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3w1kB (B:)
    mksllrqipqiskvveifakaypeiyvvkaarevaekyrkeiiegaradlngfledverk
    ikslmkpnikrvinatgvvintnlgraplskdvinfiseiangysnleynleegkrgsri
    ahiekylneltgaessfvvnnnagavflvlntlaegkeviisrgelveiggsfripdimk
    ksgailrevgttnktkvsdyegainqntallmkvhksnfymegfveevkledlvklghky
    giptyydagsgllinlkefgisvdepnfrdcislgidlvsgsgdkllggpqagiivgkkn
    liekikknpiaralridkltlsglemtlklyfekryedipvirmltqdekalrqkakrle
    kllkdipglkisvikdkakpgggslpelelptycvairhdrlssqelsrrlrlaeppivc
    riredqllfdmrtvfhedlktikktlqellsi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >3w1kC (C:)
    mksllrqipqiskvveifakaypeiyvvkaarevaekyrkeiiegaradlngfledverk
    ikslmkpnikrvinatgvvintnlgraplskdvinfiseiangysnleynleegkrgsri
    ahiekylneltgaessfvvnnnagavflvlntlaegkeviisrgelveiggsfripdimk
    ksgailrevgttnktkvsdyegainqntallmkvhksnfymegfveevkledlvklghky
    giptyydagsgllinlkefgisvdepnfrdcislgidlvsgsgdkllggpqagiivgkkn
    liekikknpiaralridkltlsglemtlklyfekryedipvirmltqdekalrqkakrle
    kllkdipglkisvikdkakpgggslpelelptycvairhdrlssqelsrrlrlaeppivc
    riredqllfdmrtvfhedlktikktlqellsi
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >3w1kD (D:)
    mksllrqipqiskvveifakaypeiyvvkaarevaekyrkeiiegaradlngfledverk
    ikslmkpnikrvinatgvvintnlgraplskdvinfiseiangysnleynleegkrgsri
    ahiekylneltgaessfvvnnnagavflvlntlaegkeviisrgelveiggsfripdimk
    ksgailrevgttnktkvsdyegainqntallmkvhksnfymegfveevkledlvklghky
    giptyydagsgllinlkefgisvdepnfrdcislgidlvsgsgdkllggpqagiivgkkn
    liekikknpiaralridkltlsglemtlklyfekryedipvirmltqdekalrqkakrle
    kllkdipglkisvikdkakpgggslpelelptycvairhdrlssqelsrrlrlaeppivc
    riredqllfdmrtvfhedlktikktlqellsi
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >3w1kE (E:)
    mksllrqipqiskvveifakaypeiyvvkaarevaekyrkeiiegaradlngfledverk
    ikslmkpnikrvinatgvvintnlgraplskdvinfiseiangysnleynleegkrgsri
    ahiekylneltgaessfvvnnnagavflvlntlaegkeviisrgelveiggsfripdimk
    ksgailrevgttnktkvsdyegainqntallmkvhksnfymegfveevkledlvklghky
    giptyydagsgllinlkefgisvdepnfrdcislgidlvsgsgdkllggpqagiivgkkn
    liekikknpiaralridkltlsglemtlklyfekryedipvirmltqdekalrqkakrle
    kllkdipglkisvikdkakpgggslpelelptycvairhdrlssqelsrrlrlaeppivc
    riredqllfdmrtvfhedlktikktlqellsi
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.