You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 3W1K

View 3W1K on RCSB PDB site
Description: Crystal structure of the selenocysteine synthase SelA and tRNASec complex
Deposited on 2012-11-15, released 2013-06-05
The last revision was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 7.5 Å
R-factor: 0.194
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-seryl-tRNA(Sec) selenium transferase
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: selA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67140 (0-451)
      • engineered mutation (18)
      • engineered mutation (20)
      • engineered mutation (45)
      • engineered mutation (47)
  • Chain 'B':
    Compound: L-seryl-tRNA(Sec) selenium transferase
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: selA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67140 (0-451)
      • engineered mutation (18)
      • engineered mutation (20)
      • engineered mutation (45)
      • engineered mutation (47)
  • Chain 'C':
    Compound: L-seryl-tRNA(Sec) selenium transferase
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: selA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67140 (0-451)
      • engineered mutation (18)
      • engineered mutation (20)
      • engineered mutation (45)
      • engineered mutation (47)
  • Chain 'D':
    Compound: L-seryl-tRNA(Sec) selenium transferase
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: selA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67140 (0-451)
      • engineered mutation (18)
      • engineered mutation (20)
      • engineered mutation (45)
      • engineered mutation (47)
  • Chain 'E':
    Compound: L-seryl-tRNA(Sec) selenium transferase
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: selA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67140 (0-451)
      • engineered mutation (18)
      • engineered mutation (20)
      • engineered mutation (45)
      • engineered mutation (47)
  • Chain 'F':
    Compound: selenocysteine tRNA
    Species: Thermoanaerobacter tengcongensis MB4, synthetic [TaxId:273068]
  • Chain 'G':
    Compound: selenocysteine tRNA
    Species: Thermoanaerobacter tengcongensis MB4, synthetic [TaxId:273068]
  • Chain 'H':
    Compound: selenocysteine tRNA
    Species: Thermoanaerobacter tengcongensis MB4, synthetic [TaxId:273068]
  • Chain 'I':
    Compound: selenocysteine tRNA
    Species: Thermoanaerobacter tengcongensis MB4, synthetic [TaxId:273068]
  • Chain 'J':
    Compound: selenocysteine tRNA
    Species: Thermoanaerobacter tengcongensis MB4, synthetic [TaxId:273068]

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3w1kA (A:)
    mksllrqipqiskvveifakaypeiyvvkaarevaekyrkeiiegaradlngfledverk
    ikslmkpnikrvinatgvvintnlgraplskdvinfiseiangysnleynleegkrgsri
    ahiekylneltgaessfvvnnnagavflvlntlaegkeviisrgelveiggsfripdimk
    ksgailrevgttnktkvsdyegainqntallmkvhksnfymegfveevkledlvklghky
    giptyydagsgllinlkefgisvdepnfrdcislgidlvsgsgdkllggpqagiivgkkn
    liekikknpiaralridkltlsglemtlklyfekryedipvirmltqdekalrqkakrle
    kllkdipglkisvikdkakpgggslpelelptycvairhdrlssqelsrrlrlaeppivc
    riredqllfdmrtvfhedlktikktlqellsi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3w1kB (B:)
    mksllrqipqiskvveifakaypeiyvvkaarevaekyrkeiiegaradlngfledverk
    ikslmkpnikrvinatgvvintnlgraplskdvinfiseiangysnleynleegkrgsri
    ahiekylneltgaessfvvnnnagavflvlntlaegkeviisrgelveiggsfripdimk
    ksgailrevgttnktkvsdyegainqntallmkvhksnfymegfveevkledlvklghky
    giptyydagsgllinlkefgisvdepnfrdcislgidlvsgsgdkllggpqagiivgkkn
    liekikknpiaralridkltlsglemtlklyfekryedipvirmltqdekalrqkakrle
    kllkdipglkisvikdkakpgggslpelelptycvairhdrlssqelsrrlrlaeppivc
    riredqllfdmrtvfhedlktikktlqellsi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >3w1kC (C:)
    mksllrqipqiskvveifakaypeiyvvkaarevaekyrkeiiegaradlngfledverk
    ikslmkpnikrvinatgvvintnlgraplskdvinfiseiangysnleynleegkrgsri
    ahiekylneltgaessfvvnnnagavflvlntlaegkeviisrgelveiggsfripdimk
    ksgailrevgttnktkvsdyegainqntallmkvhksnfymegfveevkledlvklghky
    giptyydagsgllinlkefgisvdepnfrdcislgidlvsgsgdkllggpqagiivgkkn
    liekikknpiaralridkltlsglemtlklyfekryedipvirmltqdekalrqkakrle
    kllkdipglkisvikdkakpgggslpelelptycvairhdrlssqelsrrlrlaeppivc
    riredqllfdmrtvfhedlktikktlqellsi
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >3w1kD (D:)
    mksllrqipqiskvveifakaypeiyvvkaarevaekyrkeiiegaradlngfledverk
    ikslmkpnikrvinatgvvintnlgraplskdvinfiseiangysnleynleegkrgsri
    ahiekylneltgaessfvvnnnagavflvlntlaegkeviisrgelveiggsfripdimk
    ksgailrevgttnktkvsdyegainqntallmkvhksnfymegfveevkledlvklghky
    giptyydagsgllinlkefgisvdepnfrdcislgidlvsgsgdkllggpqagiivgkkn
    liekikknpiaralridkltlsglemtlklyfekryedipvirmltqdekalrqkakrle
    kllkdipglkisvikdkakpgggslpelelptycvairhdrlssqelsrrlrlaeppivc
    riredqllfdmrtvfhedlktikktlqellsi
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >3w1kE (E:)
    mksllrqipqiskvveifakaypeiyvvkaarevaekyrkeiiegaradlngfledverk
    ikslmkpnikrvinatgvvintnlgraplskdvinfiseiangysnleynleegkrgsri
    ahiekylneltgaessfvvnnnagavflvlntlaegkeviisrgelveiggsfripdimk
    ksgailrevgttnktkvsdyegainqntallmkvhksnfymegfveevkledlvklghky
    giptyydagsgllinlkefgisvdepnfrdcislgidlvsgsgdkllggpqagiivgkkn
    liekikknpiaralridkltlsglemtlklyfekryedipvirmltqdekalrqkakrle
    kllkdipglkisvikdkakpgggslpelelptycvairhdrlssqelsrrlrlaeppivc
    riredqllfdmrtvfhedlktikktlqellsi
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.