SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.
You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 3TGS

View 3TGS on RCSB PDB site
Description: Crystal structure of HIV-1 clade C strain C1086 gp120 core in complex with NBD-556
Deposited on 2011-08-17, released 2012-04-04
The last revision was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.242
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HIV-1 clade C1086 gp120 core
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TGS (0-357)
  • Chain 'B':
    Compound: HIV-1 clade C1086 gp120 core
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TGS (0-357)
  • Heterogens: NAG, 03G, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3tgsA (A:)
    vwkeakttlfcasdakayekevhnvwathacvptdpnpqemvlanvtenfnmwkndmveq
    mhediislwdeslkpcvkltggsaitqacpkvsfdpiplhycapagfailkcnnktfngt
    gpcrnvstvqcthgikpvvstqlllngslaeeeiiirsenltnnaktiivhlnesvnivc
    trpnnggsgsggnirqahcnineskwnntlqkvgeelakhfpsktikfepssggdleitt
    hsfncrgeffycntsdlfngtyrngtynhtgrssngtitlqckikqiinmwqevgraiya
    ppiegeitcnsnitgllllrdggqsnetndtetfrpgggdmrdnwrselykykvveik
    

    Sequence, based on observed residues (ATOM records):
    >3tgsA (A:)
    vwkeakttlfcasdakayekevhnvwathacvptdpnpqemvlanvtenfnmwkndmveq
    mhediislwdeslkpcvkltggsaitqacpkvsfdpiplhycapagfailkcnnktfngt
    gpcrnvstvqcthgikpvvstqlllngslaeeeiiirsenltnnaktiivhlnesvnivc
    trpnnirqahcnineskwnntlqkvgeelakhfpsktikfepssggdleitthsfncrge
    ffycntsdlfngtyrngtynhtgrssngtitlqckikqiinmwqevgraiyappiegeit
    cnsnitgllllrdggndtetfrpgggdmrdnwrselykykvveik
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3tgsB (B:)
    vwkeakttlfcasdakayekevhnvwathacvptdpnpqemvlanvtenfnmwkndmveq
    mhediislwdeslkpcvkltggsaitqacpkvsfdpiplhycapagfailkcnnktfngt
    gpcrnvstvqcthgikpvvstqlllngslaeeeiiirsenltnnaktiivhlnesvnivc
    trpnnggsgsggnirqahcnineskwnntlqkvgeelakhfpsktikfepssggdleitt
    hsfncrgeffycntsdlfngtyrngtynhtgrssngtitlqckikqiinmwqevgraiya
    ppiegeitcnsnitgllllrdggqsnetndtetfrpgggdmrdnwrselykykvveik
    

    Sequence, based on observed residues (ATOM records):
    >3tgsB (B:)
    vwkeakttlfcasdakayekevhnvwathacvptdpnpqemvlanvtenfnmwkndmveq
    mhediislwdeslkpcvkltggsaitqacpkvsfdpiplhycapagfailkcnnktfngt
    gpcrnvstvqcthgikpvvstqlllngslaeeeiiirsenltnnaktiivhlnesvnivc
    trpnnirqahcnineskwnntlqkvgeelakhfpsktikfepssggdleitthsfncrge
    ffycntsdlfngtyrngtynhtgrssngtitlqckikqiinmwqevgraiyappiegeit
    cnsnitgllllrdggndtetfrpgggdmrdnwrselykykvveik