You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 3TGS

View 3TGS on RCSB PDB site
Description: Crystal structure of HIV-1 clade C strain C1086 gp120 core in complex with NBD-556
Deposited on 2011-08-17, released 2012-04-04
The last revision was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.242
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HIV-1 clade C1086 gp120 core
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TGS (0-357)
  • Chain 'B':
    Compound: HIV-1 clade C1086 gp120 core
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TGS (0-357)
  • Heterogens: NAG, 03G, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3tgsA (A:)
    vwkeakttlfcasdakayekevhnvwathacvptdpnpqemvlanvtenfnmwkndmveq
    mhediislwdeslkpcvkltggsaitqacpkvsfdpiplhycapagfailkcnnktfngt
    gpcrnvstvqcthgikpvvstqlllngslaeeeiiirsenltnnaktiivhlnesvnivc
    trpnnggsgsggnirqahcnineskwnntlqkvgeelakhfpsktikfepssggdleitt
    hsfncrgeffycntsdlfngtyrngtynhtgrssngtitlqckikqiinmwqevgraiya
    ppiegeitcnsnitgllllrdggqsnetndtetfrpgggdmrdnwrselykykvveik
    

    Sequence, based on observed residues (ATOM records):
    >3tgsA (A:)
    vwkeakttlfcasdakayekevhnvwathacvptdpnpqemvlanvtenfnmwkndmveq
    mhediislwdeslkpcvkltggsaitqacpkvsfdpiplhycapagfailkcnnktfngt
    gpcrnvstvqcthgikpvvstqlllngslaeeeiiirsenltnnaktiivhlnesvnivc
    trpnnirqahcnineskwnntlqkvgeelakhfpsktikfepssggdleitthsfncrge
    ffycntsdlfngtyrngtynhtgrssngtitlqckikqiinmwqevgraiyappiegeit
    cnsnitgllllrdggndtetfrpgggdmrdnwrselykykvveik
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3tgsB (B:)
    vwkeakttlfcasdakayekevhnvwathacvptdpnpqemvlanvtenfnmwkndmveq
    mhediislwdeslkpcvkltggsaitqacpkvsfdpiplhycapagfailkcnnktfngt
    gpcrnvstvqcthgikpvvstqlllngslaeeeiiirsenltnnaktiivhlnesvnivc
    trpnnggsgsggnirqahcnineskwnntlqkvgeelakhfpsktikfepssggdleitt
    hsfncrgeffycntsdlfngtyrngtynhtgrssngtitlqckikqiinmwqevgraiya
    ppiegeitcnsnitgllllrdggqsnetndtetfrpgggdmrdnwrselykykvveik
    

    Sequence, based on observed residues (ATOM records):
    >3tgsB (B:)
    vwkeakttlfcasdakayekevhnvwathacvptdpnpqemvlanvtenfnmwkndmveq
    mhediislwdeslkpcvkltggsaitqacpkvsfdpiplhycapagfailkcnnktfngt
    gpcrnvstvqcthgikpvvstqlllngslaeeeiiirsenltnnaktiivhlnesvnivc
    trpnnirqahcnineskwnntlqkvgeelakhfpsktikfepssggdleitthsfncrge
    ffycntsdlfngtyrngtynhtgrssngtitlqckikqiinmwqevgraiyappiegeit
    cnsnitgllllrdggndtetfrpgggdmrdnwrselykykvveik