You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 3RPT

View 3RPT on RCSB PDB site
Description: Crystal structure of the anti-HIV b12 scaffold protein
Class: hydrolase
Keywords: scaffold protein anti-HIV, HYDROLASE
Deposited on 2011-04-27, released 2011-12-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.175
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase e-2
    Species: THERMOBIFIDA FUSCA [TaxId:2021]
    Gene: CELB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26222 (0-70)
      • see remark 999 (40-42)
      • see remark 999 (71-72)
      • see remark 999 (82-87)
    • Uniprot P26222 (88-105)
      • see remark 999 (106-108)
      • see remark 999 (120-124)
    • Uniprot P26222 (125-273)
      • see remark 999 (157-158)
      • see remark 999 (161)
      • see remark 999 (218)
      • expression tag (274-275)
    Domains in SCOPe 2.06: d3rpta1, d3rpta2
  • Chain 'X':
    Compound: endoglucanase e-2
    Species: THERMOBIFIDA FUSCA [TaxId:2021]
    Gene: CELB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26222 (Start-70)
      • see remark 999 (40-42)
      • see remark 999 (71-73)
      • see remark 999 (82-87)
    • Uniprot P26222 (88-105)
      • see remark 999 (106-107)
      • see remark 999 (119-124)
    • Uniprot P26222 (125-273)
      • see remark 999 (157-158)
      • see remark 999 (161)
      • see remark 999 (218)
      • expression tag (274)
    Domains in SCOPe 2.06: d3rptx1, d3rptx2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rptA (A:)
    dspfyvnpnmssaewvrnnpndprtpvirdriasvpqgtwhnqhnpgqitgqvdalmsaa
    qaagkipilvvnpdpggdmdngfeegkqwidefaaglknrpayiivdpggsggdpeiaea
    awrfaayagkalkagssqariyfdaghsawhspaqmaaalqradisnsahgiatntsnyr
    wtadevayakavlsaignpslravidtsrngngpagnescdpsgraigtpsttntgdpmi
    daflwiklpgeadgciagagqfvpqaayemaiaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rptA (A:)
    dspfyvnpnmssaewvrnnpndprtpvirdriasvpqgtwhnqhqitgqvdalmsaaqaa
    gkipilvvnpfeegkqwidefaaglknrpayiivdpgawrfaayagkalkagssqariyf
    daghsawhspaqmaaalqradisnsahgiatntsnyrwtadevayakavlsaignpslra
    vidtsrngngpagnescdpsgraigtpsttntgdpmidaflwiklpgeadgciagagqfv
    pqaayemaiaale
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3rptX (X:)
    dspfyvnpnmssaewvrnnpndprtpvirdriasvpqgtwhnqhnpgqitgqvdalmsaa
    qaagkipilvvnpdpggdmdngfeegkqwidefaaglknrpayiivdpggsggdpeiaea
    awrfaayagkalkagssqariyfdaghsawhspaqmaaalqradisnsahgiatntsnyr
    wtadevayakavlsaignpslravidtsrngngpagnescdpsgraigtpsttntgdpmi
    daflwiklpgeadgciagagqfvpqaayemaiaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rptX (X:)
    spfyvnpnmssaewvrnnpndprtpvirdriasvpqgtwhnqgqitgqvdalmsaaqaag
    kipilvvnpdfeegkqwidefaaglknrpayiivdpaawrfaayagkalkagssqariyf
    daghsawhspaqmaaalqradisnsahgiatntsnyrwtadevayakavlsaignpslra
    vidtsrngngpagnescdpsgraigtpsttntgdpmidaflwiklpgeadgciagagqfv
    pqaayemaiaal