SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.
You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 3RPT

View 3RPT on RCSB PDB site
Description: Crystal structure of the anti-HIV b12 scaffold protein
Class: hydrolase
Keywords: scaffold protein anti-HIV, HYDROLASE
Deposited on 2011-04-27, released 2011-12-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.175
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase e-2
    Species: THERMOBIFIDA FUSCA [TaxId:2021]
    Gene: CELB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26222 (0-70)
      • see remark 999 (40-42)
      • see remark 999 (71-72)
      • see remark 999 (82-87)
    • Uniprot P26222 (88-105)
      • see remark 999 (106-108)
      • see remark 999 (120-124)
    • Uniprot P26222 (125-273)
      • see remark 999 (157-158)
      • see remark 999 (161)
      • see remark 999 (218)
      • expression tag (274-275)
    Domains in SCOPe 2.06: d3rpta1, d3rpta2
  • Chain 'X':
    Compound: endoglucanase e-2
    Species: THERMOBIFIDA FUSCA [TaxId:2021]
    Gene: CELB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26222 (Start-70)
      • see remark 999 (40-42)
      • see remark 999 (71-73)
      • see remark 999 (82-87)
    • Uniprot P26222 (88-105)
      • see remark 999 (106-107)
      • see remark 999 (119-124)
    • Uniprot P26222 (125-273)
      • see remark 999 (157-158)
      • see remark 999 (161)
      • see remark 999 (218)
      • expression tag (274)
    Domains in SCOPe 2.06: d3rptx1, d3rptx2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rptA (A:)
    dspfyvnpnmssaewvrnnpndprtpvirdriasvpqgtwhnqhnpgqitgqvdalmsaa
    qaagkipilvvnpdpggdmdngfeegkqwidefaaglknrpayiivdpggsggdpeiaea
    awrfaayagkalkagssqariyfdaghsawhspaqmaaalqradisnsahgiatntsnyr
    wtadevayakavlsaignpslravidtsrngngpagnescdpsgraigtpsttntgdpmi
    daflwiklpgeadgciagagqfvpqaayemaiaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rptA (A:)
    dspfyvnpnmssaewvrnnpndprtpvirdriasvpqgtwhnqhqitgqvdalmsaaqaa
    gkipilvvnpfeegkqwidefaaglknrpayiivdpgawrfaayagkalkagssqariyf
    daghsawhspaqmaaalqradisnsahgiatntsnyrwtadevayakavlsaignpslra
    vidtsrngngpagnescdpsgraigtpsttntgdpmidaflwiklpgeadgciagagqfv
    pqaayemaiaale
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3rptX (X:)
    dspfyvnpnmssaewvrnnpndprtpvirdriasvpqgtwhnqhnpgqitgqvdalmsaa
    qaagkipilvvnpdpggdmdngfeegkqwidefaaglknrpayiivdpggsggdpeiaea
    awrfaayagkalkagssqariyfdaghsawhspaqmaaalqradisnsahgiatntsnyr
    wtadevayakavlsaignpslravidtsrngngpagnescdpsgraigtpsttntgdpmi
    daflwiklpgeadgciagagqfvpqaayemaiaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rptX (X:)
    spfyvnpnmssaewvrnnpndprtpvirdriasvpqgtwhnqgqitgqvdalmsaaqaag
    kipilvvnpdfeegkqwidefaaglknrpayiivdpaawrfaayagkalkagssqariyf
    daghsawhspaqmaaalqradisnsahgiatntsnyrwtadevayakavlsaignpslra
    vidtsrngngpagnescdpsgraigtpsttntgdpmidaflwiklpgeadgciagagqfv
    pqaayemaiaal