SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.
You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 3LEX

View 3LEX on RCSB PDB site
Description: 2F5 Epitope scaffold elicited anti-HIV-1 monoclonal antibody 11F10 in complex with HIV-1 GP41
Deposited on 2010-01-15, released 2010-09-29
The last revision was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.166
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 11f10 Antibody Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LEX (0-End)
  • Chain 'B':
    Compound: 11f10 Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LEX (0-218)
  • Chain 'C':
    Compound: envelope glycoprotein gp41
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 11f10 Antibody Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LEX (0-End)
  • Chain 'L':
    Compound: 11f10 Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LEX (0-213)
  • Chain 'P':
    Compound: envelope glycoprotein gp41
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3lexA (A:)
    dvqlqesgpglvkpsqslsltctvtgysitsdyawswirqfpgnklewmgyinysgytsy
    npslksrisitrdtsenqfflqlhsvtpedtatyfcaygnylpaywgqgtlvtvsaaktt
    apsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytl
    sssvtvtsstwpsqsitcnvahpasstkvdkkieprgptik
    

    Sequence, based on observed residues (ATOM records):
    >3lexA (A:)
    dvqlqesgpglvkpsqslsltctvtgysitsdyawswirqfpgnklewmgyinysgytsy
    npslksrisitrdtsenqfflqlhsvtpedtatyfcaygnylpaywgqgtlvtvsaaktt
    apsvyplapvgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssvt
    vtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3lexB (B:)
    dvvmtqtplslsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvskla
    sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpwtfggytkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >3lexC (C:)
    lleldkwa
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3lexH (H:)
    dvqlqesgpglvkpsqslsltctvtgysitsdyawswirqfpgnklewmgyinysgytsy
    npslksrisitrdtsenqfflqlhsvtpedtatyfcaygnylpaywgqgtlvtvsaaktt
    apsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytl
    sssvtvtsstwpsqsitcnvahpasstkvdkkieprgptik
    

    Sequence, based on observed residues (ATOM records):
    >3lexH (H:)
    dvqlqesgpglvkpsqslsltctvtgysitsdyawswirqfpgnklewmgyinysgytsy
    npslksrisitrdtsenqfflqlhsvtpedtatyfcaygnylpaywgqgtlvtvsaaktt
    apsvyplapvgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssvt
    vtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records:
    >3lexL (L:)
    dvvmtqtplslsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvskla
    sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpwtfggytkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records:
    >3lexP (P:)
    lleldkwa