You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 3LEX

View 3LEX on RCSB PDB site
Description: 2F5 Epitope scaffold elicited anti-HIV-1 monoclonal antibody 11F10 in complex with HIV-1 GP41
Deposited on 2010-01-15, released 2010-09-29
The last revision was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.166
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 11f10 Antibody Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LEX (0-End)
  • Chain 'B':
    Compound: 11f10 Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LEX (0-218)
  • Chain 'C':
    Compound: envelope glycoprotein gp41
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 11f10 Antibody Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LEX (0-End)
  • Chain 'L':
    Compound: 11f10 Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LEX (0-213)
  • Chain 'P':
    Compound: envelope glycoprotein gp41
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3lexA (A:)
    dvqlqesgpglvkpsqslsltctvtgysitsdyawswirqfpgnklewmgyinysgytsy
    npslksrisitrdtsenqfflqlhsvtpedtatyfcaygnylpaywgqgtlvtvsaaktt
    apsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytl
    sssvtvtsstwpsqsitcnvahpasstkvdkkieprgptik
    

    Sequence, based on observed residues (ATOM records):
    >3lexA (A:)
    dvqlqesgpglvkpsqslsltctvtgysitsdyawswirqfpgnklewmgyinysgytsy
    npslksrisitrdtsenqfflqlhsvtpedtatyfcaygnylpaywgqgtlvtvsaaktt
    apsvyplapvgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssvt
    vtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3lexB (B:)
    dvvmtqtplslsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvskla
    sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpwtfggytkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >3lexC (C:)
    lleldkwa
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3lexH (H:)
    dvqlqesgpglvkpsqslsltctvtgysitsdyawswirqfpgnklewmgyinysgytsy
    npslksrisitrdtsenqfflqlhsvtpedtatyfcaygnylpaywgqgtlvtvsaaktt
    apsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytl
    sssvtvtsstwpsqsitcnvahpasstkvdkkieprgptik
    

    Sequence, based on observed residues (ATOM records):
    >3lexH (H:)
    dvqlqesgpglvkpsqslsltctvtgysitsdyawswirqfpgnklewmgyinysgytsy
    npslksrisitrdtsenqfflqlhsvtpedtatyfcaygnylpaywgqgtlvtvsaaktt
    apsvyplapvgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssvt
    vtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records:
    >3lexL (L:)
    dvvmtqtplslsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvskla
    sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpwtfggytkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records:
    >3lexP (P:)
    lleldkwa