You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 3LES

View 3LES on RCSB PDB site
Description: 2F5 Epitope scaffold ES2
Deposited on 2010-01-15, released 2010-09-29
The last revision was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 2.77 Å
R-factor: 0.23
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase sigma factor
    Species: Thermus aquaticus [TaxId:271]
    Gene: SIGMA FACTOR SIGA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EZJ8 (0-178)
      • engineered (12)
      • engineered (14-15)
      • engineered (17-20)
      • engineered (22-24)
      • engineered (26)
      • engineered (62)
      • engineered (154)
      • engineered (156)
  • Chain 'B':
    Compound: RNA polymerase sigma factor
    Species: Thermus aquaticus [TaxId:271]
    Gene: SIGMA FACTOR SIGA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EZJ8 (0-End)
      • engineered (12)
      • engineered (14-15)
      • engineered (17-20)
      • engineered (22-24)
      • engineered (26)
      • engineered (62)
      • engineered (154)
      • engineered (156)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3lesA (A:)
    sdpvrqylheigevleldkwaelgaaakveegmeaikklseatgldqelirevvrakilg
    taaiqkipglkekpdpktveevdgklkslpkelkrylhiaregeaarqhlieanlrlvvs
    iakkytgrglsfldliqegnqgliravekfeykrgfafstyatwwirqainraiadqar
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3lesB (B:)
    sdpvrqylheigevleldkwaelgaaakveegmeaikklseatgldqelirevvrakilg
    taaiqkipglkekpdpktveevdgklkslpkelkrylhiaregeaarqhlieanlrlvvs
    iakkytgrglsfldliqegnqgliravekfeykrgfafstyatwwirqainraiadqar
    

    Sequence, based on observed residues (ATOM records):
    >3lesB (B:)
    sdpvrqylheigevleldkwaelgaaakveegmeaikklseatgldqelirevvrakilg
    taaiqkipglkekpdpktveevdgklkslpkelkrylhiaregeaarqhlieanlrlvvs
    iakkytgrglsfldliqegnqgliravekfeykrgfafstyatwwirqainraiadq