You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 3BRD

View 3BRD on RCSB PDB site
Description: CSL (Lag-1) bound to DNA with Lin-12 RAM peptide, P212121
Class: DNA binding protein/DNA
Keywords: protein-DNA complex, signaling, transcription, Notch, DNA-binding, ANK repeat, Developmental protein, Differentiation, EGF-like domain, Glycoprotein, Membrane, Transmembrane, DNA BINDING PROTEIN/DNA COMPLEX
Deposited on 2007-12-21, released 2008-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.211
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lin-12 and glp-1 phenotype protein 1, isoform a
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: LAG-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3brda1, d3brda2, d3brda3
  • Chain 'B':
    Compound: DNA (5'-d(*dtp*dtp*dap*dcp*dtp*dgp*dtp*dgp*dgp*dgp*dap*dap*dap*dgp*da)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*dap*dap*dtp*dcp*dtp*dtp*dtp*dcp*dcp*dcp*dap*dcp*dap*dgp*dt)-3')
  • Chain 'D':
    Compound: Protein lin-12
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: lin-12
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3brdA (A:)
    gplgsgdsvqsltsdrmidflsnkekyecvisifhakvaqksygnekrffcpppciylig
    qgwklkkdrvaqlyktlkasaqkdaaiendpiheqqatelvayigigsdtserqqldfst
    gkvrhpgdqrqdpniydycaaktlyisdsdkrkyfdlnaqffygcgmeiggfvsqrikvi
    skpskkkqsmkntdckylciasgtkvalfnrlrsqtvstrylhvegnafhasstkwgaft
    ihlfdderglqetdnfavrdgfvyygsvvklvdsvtgialprlrirkvdkqqvildascs
    eepvsqlhkcafqmidnelvylclshdkiiqhqatainehrhqindgaawtiistdkaey
    rffeamgqvanpispcpvvgslevdghgeasrvelhgrdfkpnlkvwfgatpvettfrse
    eslhcsippvsqvrneqthwmftnrttgdvevpislvrddgvvyssgltfsyksler
    

    Sequence, based on observed residues (ATOM records): (download)
    >3brdA (A:)
    vqsltsdrmidflsnkekyecvisifhakvaqksygnekrffcpppciyligqgwklkkd
    rvaqlyktlqqatelvayigigsdtserqqldfpniydycaaktlyisdsdkrkyfdlna
    qffygcgmeiggfvsqrikviskpskkktdckylciasgtkvalfnrlrsqtvstrylhv
    egnafhasstkwgaftihlfddqetdnfavrdgfvyygsvvklvdsvtgialprlrirkv
    dkqqvildascseepvsqlhkcafqmidnelvylclshdkiiqhqatainehrhqindga
    awtiistdkaeyrffeamgqvanpispcpvvgslevdghgeasrvelhgrdfkpnlkvwf
    gatpvettfrseeslhcsippvsqvrneqthwmftnrttgdvevpislvrddgvvyssgl
    tfsyksl
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.