SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.
You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 3BRD

View 3BRD on RCSB PDB site
Description: CSL (Lag-1) bound to DNA with Lin-12 RAM peptide, P212121
Class: DNA binding protein/DNA
Keywords: protein-DNA complex, signaling, transcription, Notch, DNA-binding, ANK repeat, Developmental protein, Differentiation, EGF-like domain, Glycoprotein, Membrane, Transmembrane, DNA BINDING PROTEIN/DNA COMPLEX
Deposited on 2007-12-21, released 2008-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.211
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lin-12 and glp-1 phenotype protein 1, isoform a
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: LAG-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3brda1, d3brda2, d3brda3
  • Chain 'B':
    Compound: DNA (5'-d(*dtp*dtp*dap*dcp*dtp*dgp*dtp*dgp*dgp*dgp*dap*dap*dap*dgp*da)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*dap*dap*dtp*dcp*dtp*dtp*dtp*dcp*dcp*dcp*dap*dcp*dap*dgp*dt)-3')
  • Chain 'D':
    Compound: Protein lin-12
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: lin-12
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3brdA (A:)
    gplgsgdsvqsltsdrmidflsnkekyecvisifhakvaqksygnekrffcpppciylig
    qgwklkkdrvaqlyktlkasaqkdaaiendpiheqqatelvayigigsdtserqqldfst
    gkvrhpgdqrqdpniydycaaktlyisdsdkrkyfdlnaqffygcgmeiggfvsqrikvi
    skpskkkqsmkntdckylciasgtkvalfnrlrsqtvstrylhvegnafhasstkwgaft
    ihlfdderglqetdnfavrdgfvyygsvvklvdsvtgialprlrirkvdkqqvildascs
    eepvsqlhkcafqmidnelvylclshdkiiqhqatainehrhqindgaawtiistdkaey
    rffeamgqvanpispcpvvgslevdghgeasrvelhgrdfkpnlkvwfgatpvettfrse
    eslhcsippvsqvrneqthwmftnrttgdvevpislvrddgvvyssgltfsyksler
    

    Sequence, based on observed residues (ATOM records): (download)
    >3brdA (A:)
    vqsltsdrmidflsnkekyecvisifhakvaqksygnekrffcpppciyligqgwklkkd
    rvaqlyktlqqatelvayigigsdtserqqldfpniydycaaktlyisdsdkrkyfdlna
    qffygcgmeiggfvsqrikviskpskkktdckylciasgtkvalfnrlrsqtvstrylhv
    egnafhasstkwgaftihlfddqetdnfavrdgfvyygsvvklvdsvtgialprlrirkv
    dkqqvildascseepvsqlhkcafqmidnelvylclshdkiiqhqatainehrhqindga
    awtiistdkaeyrffeamgqvanpispcpvvgslevdghgeasrvelhgrdfkpnlkvwf
    gatpvettfrseeslhcsippvsqvrneqthwmftnrttgdvevpislvrddgvvyssgl
    tfsyksl
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.