PDB entry 35c8

View 35c8 on RCSB PDB site
Description: catalytic antibody 5c8, fab-inhibitor complex
Deposited on 1998-03-18, released 1999-03-23
The last revision prior to the SCOP 1.69 freeze date was dated 1999-07-09, with a file datestamp of 1999-07-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >35c8H (H:)
    evqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqkpeqglewiaqidpangntky
    dpkfqgkatitadtssntaylhlssltsedsavyycaadppyyghgdywgqgttltvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkiv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >35c8L (L:)
    divltqspaimsaslgervtmtctasssvsssnlhwyqqkpgsspklwiystsnlasgvp
    arfsgsgsgtsysltissmeaedaatyychqyhrspytfgggtkleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnr