PDB entry 32c2

View 32c2 on RCSB PDB site
Description: structure of an activity suppressing fab fragment to cytochrome p450 aromatase
Deposited on 1999-04-21, released 2000-04-26
The last revision prior to the SCOP 1.69 freeze date was dated 2000-04-26, with a file datestamp of 2000-04-26.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.213
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >32c2A (A:)
    divltqspaslavslgqratiscrasksvstsgygymhwnqqkpgqpprlliylvsnles
    gvparfsgsgsgtdftlnihpveeedaatyycqhirepltfgggtkleikradaaptvsi
    fppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmss
    tltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >32c2B (B:)
    dvqlqesgpglvkpsqslsltctvtgysissdyawnwirqfpgnklewmgyisysgstsy
    npslksrisitrdtsknqfflqlssvttedtatyycargyygsshspvwgagttvtvssa
    kttpppvyplvpgslaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkiep