PDB entry 32c2

View 32c2 on RCSB PDB site
Description:
Deposited on 1999-04-21, released 2000-04-26
The last revision prior to the SCOP 1.65 freeze date was dated 2000-04-26, with a file datestamp of 2000-04-26.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.213
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d32c2a1, d32c2a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d32c2b1, d32c2b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >32c2A (A:)
    divltqspaslavslgqratiscrasksvstsgygymhwnqqkpgqpprlliylvsnles
    gvparfsgsgsgtdftlnihpveeedaatyycqhirepltfgggtkleikradaaptvsi
    fppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmss
    tltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >32c2B (B:)
    dvqlqesgpglvkpsqslsltctvtgysissdyawnwirqfpgnklewmgyisysgstsy
    npslksrisitrdtsknqfflqlssvttedtatyycargyygsshspvwgagttvtvssa
    kttpppvyplvpgslaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkiep