PDB entry 32c2

View 32c2 on RCSB PDB site
Description: structure of an activity suppressing fab fragment to cytochrome p450 aromatase
Class: immune system
Keywords: fab, antibody, aromatase, p450, immune system
Deposited on 1999-04-21, released 2000-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.213
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg1 antibody 32c2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 32C2 (0-216)
    Domains in SCOPe 2.07: d32c2a1, d32c2a2
  • Chain 'B':
    Compound: igg1 antibody 32c2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 32C2 (0-217)
    Domains in SCOPe 2.07: d32c2b1, d32c2b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >32c2A (A:)
    divltqspaslavslgqratiscrasksvstsgygymhwnqqkpgqpprlliylvsnles
    gvparfsgsgsgtdftlnihpveeedaatyycqhirepltfgggtkleikradaaptvsi
    fppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmss
    tltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >32c2B (B:)
    dvqlqesgpglvkpsqslsltctvtgysissdyawnwirqfpgnklewmgyisysgstsy
    npslksrisitrdtsknqfflqlssvttedtatyycargyygsshspvwgagttvtvssa
    kttpppvyplvpgslaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkiep