PDB entry 2zzr

View 2zzr on RCSB PDB site
Description: Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae
Class: Hydrolase
Keywords: alpha barrel, Hydrolase
Deposited on 2009-02-24, released 2009-04-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.183
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: unsaturated glucuronyl hydrolase
    Species: Streptococcus agalactiae [TaxId:1311]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zzra_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zzrA (A:)
    mkikpvkvesienpkrflnsrlltkieveeaiekalkqlyinidyfgeeyptpatfnniy
    kvmdntewtngfwtgclwlayeynqdkklkniahknvlsflnrinnrialdhhdlgflyt
    psctaeyringdvkaleatikaadklmeryqekggfiqawgelgykehyrliidcllniq
    llffayeqtgdekyrqvavnhfyasannvvrddssafhtfyfdpetgeplkgvtrqgysd
    esswargqawgiygiplsyrkmkdyqqiilfkgmtnyflnrlpedkvsywdliftdgsgq
    prdtsatatavcgihemlkylpevdpdketykyamhtmlrslieqysnneliagrplllh
    gvyswhsgkgvdegniwgdyyylealirfykdwelyw