PDB entry 2zzj

View 2zzj on RCSB PDB site
Description: Crystal structure of endo-beta-1,4-glucuronan lyase from fungus Trichoderma reesei
Deposited on 2009-02-16, released 2009-05-05
The last revision was dated 2009-05-05, with a file datestamp of 2009-05-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucuronan lyase A
    Species: Trichoderma reesei [TaxId:51453]
    Gene: GLA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, CIT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2zzjA (A:)
trsfyndghlngwdyvrkenqgtvsevsnvvfkgtsalkmtqtytpgytgryhsevdhnr
gyqrgeeqfygfafrlsedwqfqpqsyniaqfianrpgagcggddwmpstmiwiqnnqly
sryvnghyrqpncgrnivtrpnlatvsagawhrvvlqikwasdntgyfkiwfdgakvhee
ynvattvdddsvfqfrvglyanswhddghmtgtqgfrqvwydevavgttfadvdpdqa