PDB entry 2zyd

View 2zyd on RCSB PDB site
Description: Dimeric 6-phosphogluconate dehydrogenase complexed with glucose
Class: oxidoreductase
Keywords: NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogluconate dehydrogenase, 6-phosphogluconate, Gluconate utilization, Pentose shunt
Deposited on 2009-01-19, released 2009-09-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.165
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: Escherichia coli [TaxId:83333]
    Gene: gnd
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00350
      • engineered (389)
    Domains in SCOPe 2.05: d2zyda1, d2zyda2
  • Chain 'B':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: Escherichia coli [TaxId:83333]
    Gene: gnd
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00350
      • engineered (389)
    Domains in SCOPe 2.05: d2zydb1, d2zydb2
  • Heterogens: GLO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zydA (A:)
    mghhhhhhhhhhmskqqigvvgmavmgrnlalniesrgytvsifnrsrekteeviaenpg
    kklvpyytvkefvesletprrillmvkagagtdaaidslkpyldkgdiiidggntffqdt
    irrnrelsaegfnfigtgvsggeegalkgpsimpggqkeayelvapiltkiaavaedgep
    cvtyigadgaghyvkmvhngieygdmqliaeaysllkgglnltneelaqtftewnngels
    syliditkdiftkkdedgnylvdvildeaankgtgkwtsqsaldlgeplslitesvfary
    isslkdqrvaaskvlsgpqaqpagdkaefiekvrralylgkivsyaqgfsqlraaseeyn
    wdlnygeiakifragciiraqflqkitdacaenpqianlllapyfkqiaddyqqalrdvv
    ayavqngipvptfsaavayydsyraavlpanliqaqrdyfgahtykridkegvfhtewld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zydA (A:)
    kqqigvvgmavmgrnlalniesrgytvsifnrsrekteeviaenpgkklvpyytvkefve
    sletprrillmvkagagtdaaidslkpyldkgdiiidggntffqdtirrnrelsaegfnf
    igtgvsggeegalkgpsimpggqkeayelvapiltkiaavaedgepcvtyigadgaghyv
    kmvhngieygdmqliaeaysllkgglnltneelaqtftewnngelssyliditkdiftkk
    dedgnylvdvildeaankgtgkwtsqsaldlgeplslitesvfaryisslkdqrvaaskv
    lsgpqaqpagdkaefiekvrralylgkivsyaqgfsqlraaseeynwdlnygeiakifra
    gciiraqflqkitdacaenpqianlllapyfkqiaddyqqalrdvvayavqngipvptfs
    aavayydsyraavlpanliqaqrdyfgahtykridkegvfhtew
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zydB (B:)
    mghhhhhhhhhhmskqqigvvgmavmgrnlalniesrgytvsifnrsrekteeviaenpg
    kklvpyytvkefvesletprrillmvkagagtdaaidslkpyldkgdiiidggntffqdt
    irrnrelsaegfnfigtgvsggeegalkgpsimpggqkeayelvapiltkiaavaedgep
    cvtyigadgaghyvkmvhngieygdmqliaeaysllkgglnltneelaqtftewnngels
    syliditkdiftkkdedgnylvdvildeaankgtgkwtsqsaldlgeplslitesvfary
    isslkdqrvaaskvlsgpqaqpagdkaefiekvrralylgkivsyaqgfsqlraaseeyn
    wdlnygeiakifragciiraqflqkitdacaenpqianlllapyfkqiaddyqqalrdvv
    ayavqngipvptfsaavayydsyraavlpanliqaqrdyfgahtykridkegvfhtewld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zydB (B:)
    skqqigvvgmavmgrnlalniesrgytvsifnrsrekteeviaenpgkklvpyytvkefv
    esletprrillmvkagagtdaaidslkpyldkgdiiidggntffqdtirrnrelsaegfn
    figtgvsggeegalkgpsimpggqkeayelvapiltkiaavaedgepcvtyigadgaghy
    vkmvhngieygdmqliaeaysllkgglnltneelaqtftewnngelssyliditkdiftk
    kdedgnylvdvildeaankgtgkwtsqsaldlgeplslitesvfaryisslkdqrvaask
    vlsgpqaqpagdkaefiekvrralylgkivsyaqgfsqlraaseeynwdlnygeiakifr
    agciiraqflqkitdacaenpqianlllapyfkqiaddyqqalrdvvayavqngipvptf
    saavayydsyraavlpanliqaqrdyfgahtykridkegvfhtewl