PDB entry 2zyb

View 2zyb on RCSB PDB site
Description: Crystal structure of phenylimidazo pyrazin 2 bound to the kinase domain of human LCK, (auto-phosphorylated on TYR394)
Class: transferase
Keywords: Tyrosine-protein kinase, ATP-binding, Phosphorylation, Signal transduction, Alternative splicing, Chromosomal rearrangement, Cytoplasm, Disease mutation, Host-virus interaction, Kinase, Lipoprotein, Membrane, Myristate, Nucleotide-binding, Palmitate, Phosphoprotein, Proto-oncogene, SH2 domain, SH3 domain, TRANSFERASE, Cell membrane, Polymorphism
Deposited on 2009-01-19, released 2009-02-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-03, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.183
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Gene: LCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zyba_
  • Heterogens: SO4, KSL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zybA (A:)
    qtqkpqkpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspda
    flaeanlmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldm
    aaqiaegmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpi
    kwtapeainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdn
    cpeelyqlmrlcwkerpedrptfdylrsvledfftategqyqpqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zybA (A:)
    kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean
    lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
    gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape
    ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
    qlmrlcwkerpedrptfdylrsvledfftat