PDB entry 2zy9

View 2zy9 on RCSB PDB site
Description: Improved crystal structure of magnesium transporter MgtE
Class: membrane protein, metal transport
Keywords: membrane protein, metal transport
Deposited on 2009-01-19, released 2009-12-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-09-16, with a file datestamp of 2020-09-11.
Experiment type: XRAY
Resolution: 2.94 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mg2+ transporter MgtE
    Species: Thermus thermophilus [TaxId:300852]
    Gene: MgtE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2zy9a1, d2zy9a2, d2zy9a3
  • Chain 'B':
    Compound: Mg2+ transporter MgtE
    Species: Thermus thermophilus [TaxId:300852]
    Gene: MgtE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2zy9b1, d2zy9b2, d2zy9b3
  • Heterogens: MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zy9A (A:)
    mgsshhhhhhssglgvlpggplhmeeklavslqealqegdtralrevleeihpqdllalw
    delkgehryvvltllpkakaaevlshlspeeqaeylktlppwrlreileelslddladal
    qavrkedpayfqrlkdlldprtraevealaryeedeagglmtpeyvavregmtveevlrf
    lrraapdaetiyyiyvvdekgrlkgvlslrdlivadprtrvaeimnpkvvyvrtdtdqee
    varlmadydftvlpvvdeegrlvgivtvddvldvleaeatedihklgavdvpdlvyseag
    pvalwlarvrwlvililtgmvtssilqgfesvleavtalafyvpvllgtggntgnqsatl
    iiralatrdldlrdwrrvflkemgvglllgltlsfllvgkvywdghplllpvvgvslvli
    vffanlvgamlpfllrrlgvdpalvsnplvatlsdvtglliylsvarllleav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zy9A (A:)
    evleeihpqdllalwdelkgehryvvltllpkakaaevlshlspeeqaeylktlppwrlr
    eileelslddladalqavrkedpayfqrlkdlldprtraevealaryeedeagglmtpey
    vavregmtveevlrflrraapdaetiyyiyvvdekgrlkgvlslrdlivadprtrvaeim
    npkvvyvrtdtdqeevarlmadydftvlpvvdeegrlvgivtvddvldvleaeatedihk
    lgavdvpdlvyseagpvalwlarvrwlvililtgmvtssilqgfesvleavtalafyvpv
    llgtggntgnqsatliiralatrdldlrdwrrvflkemgvglllgltlsfllvgkvywdg
    hplllpvvgvslvlivffanlvgamlpfllrrlgvdpalvsnplvatlsdvtglliylsv
    arlllea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zy9B (B:)
    mgsshhhhhhssglgvlpggplhmeeklavslqealqegdtralrevleeihpqdllalw
    delkgehryvvltllpkakaaevlshlspeeqaeylktlppwrlreileelslddladal
    qavrkedpayfqrlkdlldprtraevealaryeedeagglmtpeyvavregmtveevlrf
    lrraapdaetiyyiyvvdekgrlkgvlslrdlivadprtrvaeimnpkvvyvrtdtdqee
    varlmadydftvlpvvdeegrlvgivtvddvldvleaeatedihklgavdvpdlvyseag
    pvalwlarvrwlvililtgmvtssilqgfesvleavtalafyvpvllgtggntgnqsatl
    iiralatrdldlrdwrrvflkemgvglllgltlsfllvgkvywdghplllpvvgvslvli
    vffanlvgamlpfllrrlgvdpalvsnplvatlsdvtglliylsvarllleav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zy9B (B:)
    alrevleeihpqdllalwdelkgehryvvltllpkakaaevlshlspeeqaeylktlppw
    rlreileelslddladalqavrkedpayfqrlkdlldprtraevealaryeedeagglmt
    peyvavregmtveevlrflrraapdaetiyyiyvvdekgrlkgvlslrdlivadprtrva
    eimnpkvvyvrtdtdqeevarlmadydftvlpvvdeegrlvgivtvddvldvleaeated
    ihklgavdvpdlvyseagpvalwlarvrwlvililtgmvtssilqgfesvleavtalafy
    vpvllgtggntgnqsatliiralatrdldlrdwrrvflkemgvglllgltlsfllvgkvy
    wdghplllpvvgvslvlivffanlvgamlpfllrrlgvdpalvsnplvatlsdvtglliy
    lsvarllle