PDB entry 2zxx

View 2zxx on RCSB PDB site
Description: Crystal structure of Cdt1/geminin complex
Class: cell cycle/replication
Keywords: COILED-COIL, Cell cycle, Coiled coil, DNA replication inhibitor, Phosphoprotein, DNA replication, DNA-binding, Nucleus, Proto-oncogene, Ubl conjugation, CELL CYCLE/REPLICATION COMPLEX
Deposited on 2009-01-08, released 2009-02-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-17, with a file datestamp of 2009-02-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.237
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geminin
    Species: Mus musculus [TaxId:10090]
    Gene: geminin, Gmnn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxxa_
  • Chain 'B':
    Compound: Geminin
    Species: Mus musculus [TaxId:10090]
    Gene: geminin, Gmnn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxxb_
  • Chain 'C':
    Compound: DNA replication factor Cdt1
    Species: Mus musculus [TaxId:10090]
    Gene: Cdt1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxxc_
  • Chain 'D':
    Compound: Geminin
    Species: Mus musculus [TaxId:10090]
    Gene: geminin, Gmnn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxxd_
  • Chain 'E':
    Compound: Geminin
    Species: Mus musculus [TaxId:10090]
    Gene: geminin, Gmnn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxxe_
  • Chain 'F':
    Compound: DNA replication factor Cdt1
    Species: Mus musculus [TaxId:10090]
    Gene: Cdt1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zxxf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zxxA (A:)
    tqeafdliskenpssqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdl
    aevaehvqymaevierlsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxxA (A:)
    kenpssqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdlaevaehvqy
    maevierlsn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zxxB (B:)
    tqeafdliskenpssqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdl
    aevaehvqymaevierlsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxxB (B:)
    tqeafdliskenpssqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdl
    aevaehvqymaevierls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zxxC (C:)
    teqpcvekapayqrfhalaqpglpglvlpykyqvlvemfrsmdtivsmlhnrsetvtfak
    vkqgvqemmrkrfeernvgqiktvyptsyrfrqecnvptfkdsikrsdyqltiepllgqe
    aggatqltatcllqrrqvfrqnlvervkeqhkvflaslnppmavpddqltrwhprfnvde
    vpdiepaelpqppvtek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxxC (C:)
    kapayqrfhalaqpglpglvlpykyqvlvemfrsmdtivsmlhnrsetvtfakvkqgvqe
    mmrkrfeernvgqiktvyptsyrfrqecnvptfkdsikrsdyqltiepllgqegatqlta
    tcllqrrqvfrqnlvervkeqhkvflaslnppmavpddqltrwhprfnvdevpdiepael
    pqppv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2zxxD (D:)
    tqeafdliskenpssqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdl
    aevaehvqymaevierlsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxxD (D:)
    sqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdlaevaehvqymaevi
    erlsn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2zxxE (E:)
    tqeafdliskenpssqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdl
    aevaehvqymaevierlsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxxE (E:)
    tqeafdliskenpssqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdl
    aevaehvqymaevierls
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2zxxF (F:)
    teqpcvekapayqrfhalaqpglpglvlpykyqvlvemfrsmdtivsmlhnrsetvtfak
    vkqgvqemmrkrfeernvgqiktvyptsyrfrqecnvptfkdsikrsdyqltiepllgqe
    aggatqltatcllqrrqvfrqnlvervkeqhkvflaslnppmavpddqltrwhprfnvde
    vpdiepaelpqppvtek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxxF (F:)
    kapayqrfhalaqpglpglvlpykyqvlvemfrsmdtivsmlhnrsetvtfakvkqgvqe
    mmrkrfeernvgqiktvyptsyrfrqecnvptfkdsikrsdyqltiepllgqeatqltat
    cllqrrqvfrqnlvervkeqhkvflaslnppmavpddqltrwhprfnvdevpdiepaelp
    qppv