PDB entry 2zxn

View 2zxn on RCSB PDB site
Description: A New Class of Vitamin D Receptor Ligands that Induce Structural Rearrangement of the Ligand-binding Pocket
Class: transcription
Keywords: Nuclear receptor-agonist complex, TRANSCRIPTION, DNA-binding, Metal-binding, Nucleus, Phosphoprotein, Receptor, Transcription regulation, Zinc, Zinc-finger, Activator
Deposited on 2009-01-04, released 2009-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.209
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Nr1i1, Vdr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zxna_
  • Chain 'C':
    Compound: Mediator of RNA polymerase II transcription subunit 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: JC1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zxnA (A:)
    gshmgspnsplkdslrpklseeqqhiiailldahhktydptyadfrdfrppvrmdgstgs
    vtldlsplsmlphladlvsysiqkvigfakmipgfrdltsddqivllkssaievimlrsn
    qsftmddmswdcgsqdykydvtdvskaghtlelieplikfqvglkklnlheeehvllmai
    civspdrpgvqdaklveaiqdrlsntlqtyircrhpppgshqlyakmiqkladlrslnee
    hskqyrslsfqpensmkltplvlevfgneis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxnA (A:)
    klseeqqhiiailldahhktydptyadfrdfrppvrmsplsmlphladlvsysiqkvigf
    akmipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdykydvtdvskag
    htlelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklveaiqdrlsntlq
    tyircrhpppgshqlyakmiqkladlrslneehskqyrslsfqpensmkltplvlevfgn
    

  • Chain 'C':
    No sequence available.