PDB entry 2zwu

View 2zwu on RCSB PDB site
Description: Crystal Structure of Camphor Soaked Ferric Cytochrome P450cam
Class: oxidoreductase
Keywords: P450CAM, MONOOXYGENASE, CAMPHOR-HYDROXYLASE, HEME, IRON, METAL-BINDING, OXIDOREDUCTASE, SUBSTRATE-SOAKING, Cytoplasm
Deposited on 2008-12-18, released 2009-02-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-17, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.166
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Camphor 5-monooxygenase
    Species: Pseudomonas Putida [TaxId:303]
    Gene: CAMC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2zwua_
  • Heterogens: HEM, CAM, TRS, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zwuA (A:)
    mttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcn
    gghwiatrgqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvv
    gmpvvdklenriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlky
    ltdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeak
    rmcglllvggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgr
    iltsdyefhgvqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclg
    qhlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zwuA (A:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
    ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav