PDB entry 2zwk

View 2zwk on RCSB PDB site
Description: Crystal structure of intimin-Tir90 complex
Class: Cell Adhesion
Keywords: protein-protein complex, unique intimin-Tir octamer intermediate, Cell membrane, Cell outer membrane, Membrane, Transmembrane, Virulence, Receptor, Cell Adhesion
Deposited on 2008-12-16, released 2009-12-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-12-22, with a file datestamp of 2009-12-18.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.301
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: intimin
    Species: Escherichia coli [TaxId:155864]
    Gene: intimin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zwka1, d2zwka2
  • Chain 'B':
    Compound: Putative translocated intimin receptor protein (Translocated intimin receptor Tir)
    Species: Escherichia coli [TaxId:155864]
    Gene: tir
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: intimin
    Species: Escherichia coli [TaxId:155864]
    Gene: intimin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zwkc1, d2zwkc2
  • Chain 'D':
    Compound: Putative translocated intimin receptor protein (Translocated intimin receptor Tir)
    Species: Escherichia coli [TaxId:155864]
    Gene: tir
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: intimin
    Species: Escherichia coli [TaxId:155864]
    Gene: intimin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zwke1, d2zwke2
  • Chain 'F':
    Compound: Putative translocated intimin receptor protein (Translocated intimin receptor Tir)
    Species: Escherichia coli [TaxId:155864]
    Gene: tir
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zwkA (A:)
    mffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiatvdasg
    kvtlngkgsvvikatsgdkqtvsytikapsymikvdkqayyadamsicknllpstqtvls
    diydswgaankyshyssmnsitawikqtsseqrsgvsstynlitqnplpgvnvntpnvya
    vcve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zwkA (A:)
    ffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiatvdasgk
    vtlngkgsvvikatsgdkqtvsytikapsymikvdkqayyadamsicknllpstqtvlsd
    iydswgaankyshyssmnsitawikqtsseqrsgvsstynlitqnplpgvnvntpnvyav
    cve
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zwkC (C:)
    mffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiatvdasg
    kvtlngkgsvvikatsgdkqtvsytikapsymikvdkqayyadamsicknllpstqtvls
    diydswgaankyshyssmnsitawikqtsseqrsgvsstynlitqnplpgvnvntpnvya
    vcve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zwkC (C:)
    ffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiatvdasgk
    vtlngkgsvvikatsgdkqtvsytikapsymikvdkqayyadamsicknllpstqtvlsd
    iydswgaankyshyssmnsitawikqtsseqrsgvsstynlitqnplpgvnvntpnvyav
    cve
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2zwkE (E:)
    mffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiatvdasg
    kvtlngkgsvvikatsgdkqtvsytikapsymikvdkqayyadamsicknllpstqtvls
    diydswgaankyshyssmnsitawikqtsseqrsgvsstynlitqnplpgvnvntpnvya
    vcve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zwkE (E:)
    ffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiatvdasgk
    vtlngkgsvvikatsgdkqtvsytikapsymikvdkqayyadamsicknllpstqtvlsd
    iydswgaankyshyssmnsitawikqtsseqrsgvsstynlitqnplpgvnvntpnvyav
    cve
    

  • Chain 'F':
    No sequence available.