PDB entry 2zw0

View 2zw0 on RCSB PDB site
Description: Crystal structure of a Streptococcal protein G B1 mutant
Class: immune system
Keywords: immunoglobulin binding domain, ph-dependent ligand binding, immune system
Deposited on 2008-11-26, released 2009-03-03
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-03-03, with a file datestamp of 2009-02-27.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.179
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein LG
    Species: Finegoldia magna [TaxId:1260]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53291 (0-56)
      • engineered (36-37)
      • engineered (47-48)
    Domains in SCOPe 2.01: d2zw0a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zw0A (A:)
    mdtyklilngktlkgettteavdaataekvfkqyanehgvdgewtydpetktftvte