PDB entry 2zvu

View 2zvu on RCSB PDB site
Description: Crystal structure of rat heme oxygenase-1 in complex with ferrous verdoheme
Class: oxidoreductase
Keywords: Reaction intermediate bound structure, OXIDOREDUCTASE, Endoplasmic reticulum, Heme, Iron, Metal-binding, Microsome, Phosphoprotein
Deposited on 2008-11-21, released 2009-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-04-07, with a file datestamp of 2009-04-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.192
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: HMOX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zvua_
  • Heterogens: VEA, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zvuA (A:)
    merpqldsmsqdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiyta
    leeeiernkqnpvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhe
    vggthpellvahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkq
    lyrarmntlemtpevkhrvteeaktafllnielfeelqallteehkdqspsqteflrqrp
    aslvqdttsaetprgksqistsssqtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zvuA (A:)
    qdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiytaleeeiernkq
    npvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhevggthpellv
    ahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkqlyrarmntle
    mtpevkhrvteeaktafllnielfeelqallt