PDB entry 2zvo

View 2zvo on RCSB PDB site
Description: NEMO CoZi domain in complex with diubiquitin in C2 space group
Class: Transcription/SIGNALING PROTEIN
Keywords: NF-kB signaling, Ubiquitin binding, Coiled coil, Cytoplasm, Metal-binding, Nucleus, Phosphoprotein, Transcription, Transcription regulation, Ubl conjugation, Zinc, Zinc-finger, Transcription-SIGNALING PROTEIN COMPLEX
Deposited on 2008-11-12, released 2009-03-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UBC protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96C32 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d2zvoa1, d2zvoa2, d2zvoa3
  • Chain 'B':
    Compound: NF-kappa-B essential modulator
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O88522 (2-End)
      • engineered (34)
      • engineered (37)
  • Chain 'D':
    Compound: NF-kappa-B essential modulator
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O88522 (2-End)
      • engineered (34)
      • engineered (37)
  • Chain 'G':
    Compound: UBC protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zvog1, d2zvog2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zvoA (A:)
    gsmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsd
    yniqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqr
    lifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zvoA (A:)
    smqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdy
    niqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrl
    ifagkqledgrtlsdyniqkestlhlvlr
    

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2zvoG (G:)
    gsmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsd
    yniqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqr
    lifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zvoG (G:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlv