PDB entry 2zvj

View 2zvj on RCSB PDB site
Description: Crystal structures of rat Catechol-O-Methyltransferase complexed with coumarine-based inhibitor
Class: transferase
Keywords: Transferase, Methyltransferase, Neurotransmitter degradation, Alternative initiation, Catecholamine metabolism, Cell membrane, Cytoplasm, Magnesium, Membrane, Metal-binding, Phosphoprotein, S-adenosyl-L-methionine, Signal-anchor, Transmembrane
Deposited on 2008-11-07, released 2009-01-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-01-06, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.219
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catechol O-methyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zvja_
  • Heterogens: MG, SAM, KOM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zvjA (A:)
    gsmgdtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireys
    pslvlelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilnga
    sqdlipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpd
    flayvrgsssfecthyssyleymkvvdglekaiyqgpsspdks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zvjA (A:)
    dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv
    lelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqdl
    ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay
    vrgsssfecthyssyleymkvvdglekaiyqg