PDB entry 2zvi

View 2zvi on RCSB PDB site
Description: Crystal structure of 2,3-diketo-5-methylthiopentyl-1-phosphate enolase from Bacillus subtilis
Class: isomerase
Keywords: CRYSTAL STRUCTURE, ENOLASE, METHIONINE SALVAGE PATHWAY, Amino-acid biosynthesis, Isomerase, Magnesium, Metal-binding, Methionine biosynthesis
Deposited on 2008-11-07, released 2009-09-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.201
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2,3-diketo-5-methylthiopentyl-1-phosphate enolase
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zvia1, d2zvia2
  • Chain 'B':
    Compound: 2,3-diketo-5-methylthiopentyl-1-phosphate enolase
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zvib1, d2zvib2
  • Chain 'C':
    Compound: 2,3-diketo-5-methylthiopentyl-1-phosphate enolase
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zvic1, d2zvic2
  • Chain 'D':
    Compound: 2,3-diketo-5-methylthiopentyl-1-phosphate enolase
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zvid1, d2zvid2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zviA (A:)
    mgsshhhhhhssglvprgshmsellatylltepgadtekkaeqiatgltvgswtdlplvk
    qeqmqkhkgrvikveeregtaasekqavitiaypeinfsqdipallttvfgklsldgkik
    lidlhfseafkralpgpkfgvygirkllgeferpllmsifkgvigrdlsdikeqlrqqal
    ggvdlikddeiffetglapfetriaegkqilketyeqtghktlyavnltgrtadlkdkar
    raaelgadallfnvfaygldvmqglaedpeipvpimahpavsgaftsspfygfshalllg
    klnrycgadfslfpspygsvalpradalaiheecvredafnqtfavpsagihpgmvpllm
    rdfgidhiinagggvhghpngaqgggrafraiidavleaqpidekaeqckdlklaldkwg
    kaeav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zviA (A:)
    sellatylltepdtekkaeqiatgltvgswtdlplvkqeqmqkhkgrvikveeraasekq
    avitiaypeinfsqdipallttvfgklsldgkiklidlhfseafkralpgpkfgvygirk
    llgeferpllmsifkgvigrdlsdikeqlrqqalggvdlikddeiffetglapfetriae
    gkqilketyeqtghktlyavnltgrtadlkdkarraaelgadallfnvfaygldvmqgla
    edpeipvpimahpavsgaftsspfygfshalllgklnrycgadfslfpspygsvalprad
    alaiheecvredafnqtfavpsagihpgmvpllmrdfgidhiinagggvhghpngaqggg
    rafraiidavleaqpidekaeqckdlklaldkwgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zviB (B:)
    mgsshhhhhhssglvprgshmsellatylltepgadtekkaeqiatgltvgswtdlplvk
    qeqmqkhkgrvikveeregtaasekqavitiaypeinfsqdipallttvfgklsldgkik
    lidlhfseafkralpgpkfgvygirkllgeferpllmsifkgvigrdlsdikeqlrqqal
    ggvdlikddeiffetglapfetriaegkqilketyeqtghktlyavnltgrtadlkdkar
    raaelgadallfnvfaygldvmqglaedpeipvpimahpavsgaftsspfygfshalllg
    klnrycgadfslfpspygsvalpradalaiheecvredafnqtfavpsagihpgmvpllm
    rdfgidhiinagggvhghpngaqgggrafraiidavleaqpidekaeqckdlklaldkwg
    kaeav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zviB (B:)
    sellatylltepgadtekkaeqiatgltvgswtdlplvkqeqmqkhkgrvikveersekq
    avitiaypeinfsqdipallttvfgklsldgkiklidlhfseafkralpgpkfgvygirk
    llgeferpllmsifkgvigrdlsdikeqlrqqalggvdlikddeiffetglapfetriae
    gkqilketyeqtghktlyavnltgrtadlkdkarraaelgadallfnvfaygldvmqgla
    edpeipvpimahpavsgaftsspfygfshalllgklnrycgadfslfpspygsvalprad
    alaiheecvredafnqtfavpsagihpgmvpllmrdfgidhiinagggvhghpngaqggg
    rafraiidavleaqpidekaeqckdlklaldkwgka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zviC (C:)
    mgsshhhhhhssglvprgshmsellatylltepgadtekkaeqiatgltvgswtdlplvk
    qeqmqkhkgrvikveeregtaasekqavitiaypeinfsqdipallttvfgklsldgkik
    lidlhfseafkralpgpkfgvygirkllgeferpllmsifkgvigrdlsdikeqlrqqal
    ggvdlikddeiffetglapfetriaegkqilketyeqtghktlyavnltgrtadlkdkar
    raaelgadallfnvfaygldvmqglaedpeipvpimahpavsgaftsspfygfshalllg
    klnrycgadfslfpspygsvalpradalaiheecvredafnqtfavpsagihpgmvpllm
    rdfgidhiinagggvhghpngaqgggrafraiidavleaqpidekaeqckdlklaldkwg
    kaeav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zviC (C:)
    sellatylltepgadtekkaeqiatgltvvkqeqmqkhkgrvikveerekqavitiaype
    infsqdipallttvfgklsldgkiklidlhfseafkralpgpkfgvygirkllgeferpl
    lmsifkgvigrdlsdikeqlrqqalggvdlikddeiffetglapfetriaegkqilkety
    eqtghktlyavnltgrtadlkdkarraaelgadallfnvfaygldvmqglaedpeipvpi
    mahpavsgaftsspfygfshalllgklnrycgadfslfpspygsvalpradalaiheecv
    redafnqtfavpsagihpgmvpllmrdfgidhiinagggvhghpngaqgggrafraiida
    vleaqpidekaeqckdlklaldkwg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2zviD (D:)
    mgsshhhhhhssglvprgshmsellatylltepgadtekkaeqiatgltvgswtdlplvk
    qeqmqkhkgrvikveeregtaasekqavitiaypeinfsqdipallttvfgklsldgkik
    lidlhfseafkralpgpkfgvygirkllgeferpllmsifkgvigrdlsdikeqlrqqal
    ggvdlikddeiffetglapfetriaegkqilketyeqtghktlyavnltgrtadlkdkar
    raaelgadallfnvfaygldvmqglaedpeipvpimahpavsgaftsspfygfshalllg
    klnrycgadfslfpspygsvalpradalaiheecvredafnqtfavpsagihpgmvpllm
    rdfgidhiinagggvhghpngaqgggrafraiidavleaqpidekaeqckdlklaldkwg
    kaeav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zviD (D:)
    sellatylltepgadtekkaeqiatgplvkqeqmqkhkgrvikveerekqavitiaypei
    nfsqdipallttvfgklsldgkiklidlhfseafkralpgpkfgvygirkllgeferpll
    msifkgvigrdlsdikeqlrqqalggvdlikddeiffetglapfetriaegkqilketye
    qtghktlyavnltgrtadlkdkarraaelgadallfnvfaygldvmqglaedpeipvpim
    ahpavsgaftsspfygfshalllgklnrycgadfslfpspygsvalpradalaiheecvr
    edafnqtfavpsagihpgmvpllmrdfgidhiinagggvhghpngaqgggrafraiidav
    leaqpidekaeqckdlklaldkwgkaea