PDB entry 2zv7

View 2zv7 on RCSB PDB site
Description: Lyn Tyrosine Kinase Domain, apo form
Class: transferase
Keywords: Lyn Kinase, Alternative splicing, ATP-binding, Kinase, Lipoprotein, Myristate, Nucleotide-binding, Palmitate, Phosphoprotein, Proto-oncogene, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase
Deposited on 2008-11-04, released 2008-11-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-01-13, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.206
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein kinase lyn
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25911 (5-End)
      • expression tag (4)
    Domains in SCOPe 2.06: d2zv7a1, d2zv7a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zv7A (A:)
    gamdpaweipresiklvkklgagqfgevwmgyynnstkvavktlkpgtmsvqafleeanl
    mktlqhdklvrlyavvtkeepiyiitefmakgslldflksdeggkvllpklidfsaqiae
    gmayierknyihrdlraanvlvseslmckiadfglarviedneytaregakfpikwtape
    ainfgcftiksnvwsfgillyeivtygkipypgrtnadvmsalsqgyrmprmencpdely
    dimkmcwkekaeerptfdylqsvlddfytategqyqqqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zv7A (A:)
    paweipresiklvkklgagqfgevwmgyynnstkvavktlkpgtmsvqafleeanlmktl
    qhdklvrlyavvtkeepiyiitefmakgslldflksdeggkvllpklidfsaqiaegmay
    ierknyihrdlraanvlvseslmckiadfglarviregakfpikwtapeainfgcftiks
    nvwsfgillyeivtygkipypgrtnadvmsalsqgyrmprmencpdelydimkmcwkeka
    eerptfdylqsvlddfy