PDB entry 2zub

View 2zub on RCSB PDB site
Description: Left handed RadA
Class: recombination
Keywords: ARCHAEA, FILAMENT, LEFT-HANDED, DNA BINDING, RECOMBINATION, MOLECULAR SWITCH, RECA, RAD51, DMC1, ATP-binding, DNA damage, DNA recombination, DNA-binding, Nucleotide-binding
Deposited on 2008-10-15, released 2009-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-04-07, with a file datestamp of 2009-04-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.225
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair and recombination protein radA
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: RADA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zuba1, d2zuba2
  • Chain 'B':
    Compound: DNA repair and recombination protein radA
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: RADA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zubb1, d2zubb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zubA (A:)
    msneveqkkniktindlpgisqtvinklieagyssletlavaspqdlsvaagiplstaqk
    iikeardaldirfktalevkkermnvkkistgsqaldgllaggietrtmteffgefgsgk
    tqlchqlsvnvqlppekgglsgkavyidtegtfrwerienmakalgldidnvmnniyyir
    aintdhqiaivddlqelvskdpsiklivvdsvtshfraeypgrenlavrqqklnkhlhql
    trlaevydiaviitnqvmarpdmfygdptvavgghtlyhvpgiriqlkksrgnrriarvv
    daphlpegevvfalteegirdaee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zubA (A:)
    tindlpgisqtvinklieagyssletlavaspqdlsvaagiplstaqkiikeardaldir
    fktalevkkermnvkkistgsqaldgllaggietrtmteffgefgsgktqlchqlsvnvq
    lppekgglsgkavyidtegtfrwerienmakalgldidnvmnniyyiraintdhqiaivd
    dlqelvskdpsiklivvdsvtshfraeypgrenlavrqqklnkhlhqltrlaevydiavi
    itnqvmhvpgiriqlkksrgnrriarvvdaphlpegevvfalteegirda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zubB (B:)
    msneveqkkniktindlpgisqtvinklieagyssletlavaspqdlsvaagiplstaqk
    iikeardaldirfktalevkkermnvkkistgsqaldgllaggietrtmteffgefgsgk
    tqlchqlsvnvqlppekgglsgkavyidtegtfrwerienmakalgldidnvmnniyyir
    aintdhqiaivddlqelvskdpsiklivvdsvtshfraeypgrenlavrqqklnkhlhql
    trlaevydiaviitnqvmarpdmfygdptvavgghtlyhvpgiriqlkksrgnrriarvv
    daphlpegevvfalteegirdaee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zubB (B:)
    tindlpgisqtvinklieagyssletlavaspqdlsvaagiplstaqkiikeardaldir
    fktalevkkermnvkkistgsqaldgllaggietrtmteffgefgsgktqlchqlsvnvq
    lppekgglsgkavyidtegtfrwerienmakalgldidnvmnniyyiraintdhqiaivd
    dlqelvskdpsiklivvdsvtshfraeypgrenlavrqqklnkhlhqltrlaevydiavi
    itnqvmhvpgiriqlkksrgnrriarvvdaphlpegevvfalteegirda