PDB entry 2zua

View 2zua on RCSB PDB site
Description: Crystal structure of nucleoside diphosphate kinase from Haloarcula quadrata
Class: transferase
Keywords: ferredoxin fold, Kpn loop, transferase, Kinase
Deposited on 2008-10-15, released 2009-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.225
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Haloarcula quadrata [TaxId:182779]
    Gene: ndk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zuaa_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: Haloarcula quadrata [TaxId:182779]
    Gene: ndk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zuab_
  • Chain 'C':
    Compound: Nucleoside diphosphate kinase
    Species: Haloarcula quadrata [TaxId:182779]
    Gene: ndk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zuac_
  • Chain 'D':
    Compound: Nucleoside diphosphate kinase
    Species: Haloarcula quadrata [TaxId:182779]
    Gene: ndk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zuad_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zuaA (A:)
    mgsshhhhhhssglvprgshmsehertfvmvkpdgvqrgligdivsrfedrglkmvggkf
    mqidqelaeehygehedkpffdglvdfitsgpvfamvwegqdatrqvrtmmgetdpaesa
    pgtirgdygldlgrnvihgsdhedeganereielffdedelvdwdqidsswlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zuaA (A:)
    sehertfvmvkpdgvqrgligdivsrfedrglkmvggkfmqidqelaeehygehedkpff
    dglvdfitsgpvfamvwegqdatrqvrtmmgetdpaesapgtirgdygldlgrnvihgsd
    hedeganereielffdedelvdwdqidsswlye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zuaB (B:)
    mgsshhhhhhssglvprgshmsehertfvmvkpdgvqrgligdivsrfedrglkmvggkf
    mqidqelaeehygehedkpffdglvdfitsgpvfamvwegqdatrqvrtmmgetdpaesa
    pgtirgdygldlgrnvihgsdhedeganereielffdedelvdwdqidsswlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zuaB (B:)
    ehertfvmvkpdgvqrgligdivsrfedrglkmvggkfmqidqelaeehygehedkpffd
    glvdfitsgpvfamvwegqdatrqvrtmmgetdpaesapgtirgdygldlgrnvihgsdh
    edeganereielffdedelvdwdqidsswlye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zuaC (C:)
    mgsshhhhhhssglvprgshmsehertfvmvkpdgvqrgligdivsrfedrglkmvggkf
    mqidqelaeehygehedkpffdglvdfitsgpvfamvwegqdatrqvrtmmgetdpaesa
    pgtirgdygldlgrnvihgsdhedeganereielffdedelvdwdqidsswlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zuaC (C:)
    sehertfvmvkpdgvqrgligdivsrfedrglkmvggkfmqidqelaeehygehedkpff
    dglvdfitsgpvfamvwegqdatrqvrtmmgetdpaesapgtirgdygldlgrnvihgsd
    hedeganereielffdedelvdwdqidsswlye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2zuaD (D:)
    mgsshhhhhhssglvprgshmsehertfvmvkpdgvqrgligdivsrfedrglkmvggkf
    mqidqelaeehygehedkpffdglvdfitsgpvfamvwegqdatrqvrtmmgetdpaesa
    pgtirgdygldlgrnvihgsdhedeganereielffdedelvdwdqidsswlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zuaD (D:)
    sehertfvmvkpdgvqrgligdivsrfedrglkmvggkfmqidqelaeehygehedkpff
    dglvdfitsgpvfamvwegqdatrqvrtmmgetdpaesapgtirgdygldlgrnvihgsd
    hedeganereielffdedelvdwdqidsswlye