PDB entry 2zu2

View 2zu2 on RCSB PDB site
Description: complex structure of CoV 229E 3CL protease with EPDTC
Class: hydrolase/hydrolase inhibitor
Keywords: protease-inhibitor complex, Hydrolase, Metal-binding, Protease, Thiol protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2008-10-12, released 2009-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3C-like proteinase
    Species: Human coronavirus [TaxId:11137]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zu2a_
  • Chain 'B':
    Compound: 3C-like proteinase
    Species: Human coronavirus [TaxId:11137]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zu2b_
  • Heterogens: MPD, DTZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zu2A (A:)
    aglrkmaqpsgfvekcvvrvcygntvlnglwlgdivycprhviasnttsaidydheysim
    rlhnfsiisgtaflgvvgatmhgvtlkikvsqtnmhtprhsfrtlksgegfnilacydgc
    aqgvfgvnmrtnwtirgsfingacgspgynlkngevefvymhqielgsgshvgssfdgvm
    yggfedqpnlqvesanqmltvnvvaflyaailngctwwlkgeklfvehynewaqangfta
    mngedafsilaaktgvcverllhaiqvlnngfggkqilgysslndefsinevvkqmfgvn
    lq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zu2A (A:)
    aglrkmaqpsgfvekcvvrvcygntvlnglwlgdivycprhviasnttsaidydheysim
    rlhnfsiisgtaflgvvgatmhgvtlkikvsqtnmhtprhsfrtlksgegfnilacydgc
    aqgvfgvnmrtnwtirgsfingacgspgynlkngevefvymhqielgsgshvgssfdgvm
    yggfedqpnlqvesanqmltvnvvaflyaailngctwwlkgeklfvehynewaqangfta
    mngedafsilaaktgvcverllhaiqvlnngfggkqilgysslndefsinevvkqmfgvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zu2B (B:)
    aglrkmaqpsgfvekcvvrvcygntvlnglwlgdivycprhviasnttsaidydheysim
    rlhnfsiisgtaflgvvgatmhgvtlkikvsqtnmhtprhsfrtlksgegfnilacydgc
    aqgvfgvnmrtnwtirgsfingacgspgynlkngevefvymhqielgsgshvgssfdgvm
    yggfedqpnlqvesanqmltvnvvaflyaailngctwwlkgeklfvehynewaqangfta
    mngedafsilaaktgvcverllhaiqvlnngfggkqilgysslndefsinevvkqmfgvn
    lq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zu2B (B:)
    aglrkmaqpsgfvekcvvrvcygntvlnglwlgdivycprhviasnttsaidydheysim
    rlhnfsiisgtaflgvvgatmhgvtlkikvsqtnmhtprhsfrtlksgegfnilacydgc
    aqgvfgvnmrtnwtirgsfingacgspgynlkngevefvymhqielgsgshvgssfdgvm
    yggfedqpnlqvesanqmltvnvvaflyaailngctwwlkgeklfvehynewaqangfta
    mngedafsilaaktgvcverllhaiqvlnngfggkqilgysslndefsinevvkqmfgvn
    l