PDB entry 2zu0

View 2zu0 on RCSB PDB site
Description: Crystal structure of SufC-SufD complex involved in the iron-sulfur cluster biosynthesis
Class: Biosynthetic Protein/Protein Binding
Keywords: Iron-sulfur cluster, ABC-ATPase, ATP-binding, Cytoplasm, Nucleotide-binding, Transport, Biosynthetic Protein/Protein Binding COMPLEX
Deposited on 2008-10-11, released 2009-03-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-04-21, with a file datestamp of 2009-04-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.234
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein sufD
    Species: Escherichia coli [TaxId:83333]
    Gene: SufC and SufD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2zu0a_
  • Chain 'B':
    Compound: Protein sufD
    Species: Escherichia coli [TaxId:83333]
    Gene: SufC and SufD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2zu0b_
  • Chain 'C':
    Compound: Probable ATP-dependent transporter sufC
    Species: Escherichia coli [TaxId:83333]
    Gene: SufC and SufD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2zu0c_
  • Chain 'D':
    Compound: Probable ATP-dependent transporter sufC
    Species: Escherichia coli [TaxId:83333]
    Gene: SufC and SufD
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zu0A (A:)
    maglpnssnalqqwhhlfeaegtkrspqaqqhlqqllrtglptrkhenwkytpleglins
    qfvsiageispqqrdalaltldsvrlvfvdgryvpalsdategsgyevsinddrqglpda
    iqaevflhlteslaqsvthiavkrgqrpakplllmhitqgvageevntahyrhhldlaeg
    aeatviehfvslndarhftgarftinvaanahlqhiklafenplshhfahndlllaedat
    afshsfllggavlrhntstqlngenstlrinslampvknevcdtrtwlehnkgfcnsrql
    hktivsdkgravfnglinvaqhaiktdgqmtnnnllmgklaevdtkpqleiyaddvkcsh
    gatvgriddeqifylrsrginqqdaqqmiiyafaaeltealrdeglkqqvlarigqrlpg
    gar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zu0A (A:)
    snalqqwhhlfeaegtkrspqaqqhlqqllrtglptrkhenwkytpleglinsqfvsiag
    eispqqrdalaltldsvrlvfvdgryvpalsdategsgyevsinddrqglpdaiqaevfl
    hlteslaqsvthiavkrgqrpakplllmhitqgvageevntahyrhhldlaegaeatvie
    hfvslndarhftgarftinvaanahlqhiklafenplshhfahndlllaedatafshsfl
    lggavlrhntstqlngenstlrinslampvknevcdtrtwlehnkgfcnsrqlhktivsd
    kgravfnglinvaqhaiktdgqmtnnnllmgklaevdtkpqleiyaddvkcshgatvgri
    ddeqifylrsrginqqdaqqmiiyafaaeltealrdeglkqqvlarigqrlpggar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zu0B (B:)
    maglpnssnalqqwhhlfeaegtkrspqaqqhlqqllrtglptrkhenwkytpleglins
    qfvsiageispqqrdalaltldsvrlvfvdgryvpalsdategsgyevsinddrqglpda
    iqaevflhlteslaqsvthiavkrgqrpakplllmhitqgvageevntahyrhhldlaeg
    aeatviehfvslndarhftgarftinvaanahlqhiklafenplshhfahndlllaedat
    afshsfllggavlrhntstqlngenstlrinslampvknevcdtrtwlehnkgfcnsrql
    hktivsdkgravfnglinvaqhaiktdgqmtnnnllmgklaevdtkpqleiyaddvkcsh
    gatvgriddeqifylrsrginqqdaqqmiiyafaaeltealrdeglkqqvlarigqrlpg
    gar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zu0B (B:)
    nalqqwhhlfeaegtkrspqaqqhlqqllrtglptrkhenwkytpleglinsqfvsiage
    ispqqrdalaltldsvrlvfvdgryvpalsdategsgyevsinddrqglpdaiqaevflh
    lteslaqsvthiavkrgqrpakplllmhitqgvageevntahyrhhldlaegaeatvieh
    fvslndarhftgarftinvaanahlqhiklafenplshhfahndlllaedatafshsfll
    ggavlrhntstqlngenstlrinslampvknevcdtrtwlehnkgfcnsrqlhktivsdk
    gravfnglinvaqhaiktdgqmtnnnllmgklaevdtkpqleiyaddvkcshgatvgrid
    deqifylrsrginqqdaqqmiiyafaaeltealrdeglkqqvlarigqrlpgga
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zu0C (C:)
    mgsshhhhhssglvprgshmlsikdlhvsvedkailrglsldvhpgevhaimgpngsgks
    tlsatlagredyevtggtvefkgkdllalspedragegifmafqypveipgvsnqfflqt
    alnavrsyrgqetldrfdfqdlmeekiallkmpedlltrsvnvgfsggekkrndilqmav
    lepelcildesdsgldidalkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyq
    grivksgdftlvkqleeqgygwlteqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zu0C (C:)
    mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv
    efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf
    qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsgldida
    lkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkqleeqg
    ygwlteq
    

  • Chain 'D':
    No sequence available.