PDB entry 2ztv

View 2ztv on RCSB PDB site
Description: The binary complex of D-3-hydroxybutyrate dehydrogenase with NAD+
Class: oxidoreductase
Keywords: short chain dehydrogenase/reductase, SDR family, NAD, NADH, HBDH, OXIDOREDUCTASE
Deposited on 2008-10-09, released 2009-08-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.202
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D(-)-3-hydroxybutyrate dehydrogenase
    Species: Pseudomonas fragi [TaxId:296]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ztva_
  • Chain 'B':
    Compound: D(-)-3-hydroxybutyrate dehydrogenase
    Species: Pseudomonas fragi [TaxId:296]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ztvb_
  • Chain 'C':
    Compound: D(-)-3-hydroxybutyrate dehydrogenase
    Species: Pseudomonas fragi [TaxId:296]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ztvc_
  • Chain 'D':
    Compound: D(-)-3-hydroxybutyrate dehydrogenase
    Species: Pseudomonas fragi [TaxId:296]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ztvd_
  • Heterogens: NAD, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ztvA (A:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvrtplvekqisalaekngvdqetaarellsekqpslqfvtpeqlggtavflas
    daaaqitgttvsvdggwtar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ztvB (B:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvrtplvekqisalaekngvdqetaarellsekqpslqfvtpeqlggtavflas
    daaaqitgttvsvdggwtar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ztvB (B:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvrtplvektaarellsekqpslqfvtpeqlggtavflasdaaaqitgttvsvd
    ggwtar
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ztvC (C:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvrtplvekqisalaekngvdqetaarellsekqpslqfvtpeqlggtavflas
    daaaqitgttvsvdggwtar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ztvC (C:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvrtplvekqisagvdqetaarellsekqpslqfvtpeqlggtavflasdaaaq
    itgttvsvdggwtar
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ztvD (D:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvrtplvekqisalaekngvdqetaarellsekqpslqfvtpeqlggtavflas
    daaaqitgttvsvdggwtar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ztvD (D:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvrtplvekqisvdqetaarellsekqpslqfvtpeqlggtavflasdaaaqit
    gttvsvdggwtar