PDB entry 2ztu

View 2ztu on RCSB PDB site
Description: T190A mutant of D-3-hydroxybutyrate dehydrogenase complexed with NAD+
Class: oxidoreductase
Keywords: short chain dehydrogenase/reductase, SDR family, NAD, NADH, HBDH, OXIDOREDUCTASE
Deposited on 2008-10-09, released 2009-08-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.238
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D(-)-3-hydroxybutyrate dehydrogenase
    Species: Pseudomonas fragi [TaxId:296]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ztua_
  • Chain 'B':
    Compound: D(-)-3-hydroxybutyrate dehydrogenase
    Species: Pseudomonas fragi [TaxId:296]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ztub_
  • Chain 'C':
    Compound: D(-)-3-hydroxybutyrate dehydrogenase
    Species: Pseudomonas fragi [TaxId:296]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ztuc_
  • Chain 'D':
    Compound: D(-)-3-hydroxybutyrate dehydrogenase
    Species: Pseudomonas fragi [TaxId:296]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ztud_
  • Heterogens: NAD, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ztuA (A:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvraplvekqisalaekngvdqetaarellsekqpslqfvtpeqlggtavflas
    daaaqitgttvsvdggwtar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ztuA (A:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvrllsekqpslqfvtpeqlggtavflasdaaaqitgttvsvdggwtar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ztuB (B:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvraplvekqisalaekngvdqetaarellsekqpslqfvtpeqlggtavflas
    daaaqitgttvsvdggwtar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ztuB (B:)
    vvtgstsgiglgiatalaaqgadivlngflydgadlskgeavrglvdnavrqmgridilv
    nnagiqhtaliedfptekwdailalnlsavfhgtaaalphmkkqgfgriiniasahglva
    sanksayvaakhgvvgftkvtaletagqgitanaicpgwvellsekqpslqfvtpeqlgg
    tavflasdaaaqitgttvsvdggwtar
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ztuC (C:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvraplvekqisalaekngvdqetaarellsekqpslqfvtpeqlggtavflas
    daaaqitgttvsvdggwtar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ztuC (C:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvrqetaarellsekqpslqfvtpeqlggtavflasdaaaqitgttvsvdggwt
    ar
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ztuD (D:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvraplvekqisalaekngvdqetaarellsekqpslqfvtpeqlggtavflas
    daaaqitgttvsvdggwtar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ztuD (D:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvretaarellsekqpslqfvtpeqlggtavflasdaaaqitgttvsvdggwta
    r