PDB entry 2ztm

View 2ztm on RCSB PDB site
Description: T190S mutant of D-3-hydroxybutyrate dehydrogenase
Class: oxidoreductase
Keywords: short chain dehydrogenase redactase, SDR family, NAD, NADH, HBDH, OXIDOREDUCTASE
Deposited on 2008-10-07, released 2009-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.227
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D(-)-3-hydroxybutyrate dehydrogenase
    Species: Pseudomonas fragi [TaxId:296]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5KST5 (Start-259)
      • engineered (189)
    Domains in SCOPe 2.07: d2ztma_
  • Chain 'B':
    Compound: D(-)-3-hydroxybutyrate dehydrogenase
    Species: Pseudomonas fragi [TaxId:296]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5KST5 (Start-259)
      • engineered (189)
    Domains in SCOPe 2.07: d2ztmb_
  • Chain 'C':
    Compound: D(-)-3-hydroxybutyrate dehydrogenase
    Species: Pseudomonas fragi [TaxId:296]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5KST5 (0-259)
      • engineered (189)
    Domains in SCOPe 2.07: d2ztmc_
  • Chain 'D':
    Compound: D(-)-3-hydroxybutyrate dehydrogenase
    Species: Pseudomonas fragi [TaxId:296]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5KST5 (0-259)
      • engineered (189)
    Domains in SCOPe 2.07: d2ztmd_
  • Heterogens: NAD, 3HL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ztmA (A:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvrsplvekqisalaekngvdqetaarellsekqpslqfvtpeqlggtavflas
    daaaqitgttvsvdggwtar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ztmA (A:)
    vavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlydgadls
    kgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfhgtaaa
    lphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgitanaicp
    gwvrsplvekqisalaekngvdqetaarellsekqpslqfvtpeqlggtavflasdaaaq
    itgttvsvdggwtar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ztmB (B:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvrsplvekqisalaekngvdqetaarellsekqpslqfvtpeqlggtavflas
    daaaqitgttvsvdggwtar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ztmB (B:)
    kvavvtgstsgiglgiatalaaqgadivlngfglaaqhgvkvlydgadlskgeavrglvd
    navrqmgridilvnnagiqhtaliedfptekwdailalnlsavfhgtaaalphmkkqgfg
    riiniasahglvasanksayvaakhgvvgftkvtaletagqgitanaicpgwvrsarell
    sekqpslqfvtpeqlggtavflasdaaaqitgttvsvdggwtar
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ztmC (C:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvrsplvekqisalaekngvdqetaarellsekqpslqfvtpeqlggtavflas
    daaaqitgttvsvdggwtar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ztmC (C:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvrsplvekqisalaekellsekqpslqfvtpeqlggtavflasdaaaqitgtt
    vsvdggwtar
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ztmD (D:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvrsplvekqisalaekngvdqetaarellsekqpslqfvtpeqlggtavflas
    daaaqitgttvsvdggwtar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ztmD (D:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvrsplvekqisarellsekqpslqfvtpeqlggtavflasdaaaqitgttvsv
    dggwtar