PDB entry 2ztl

View 2ztl on RCSB PDB site
Description: Closed conformation of D-3-hydroxybutyrate dehydrogenase complexed with NAD+ and L-3-hydroxybutyrate
Class: oxidoreductase
Keywords: short chain dehydrogenase/reductase, SDR family, NAD, NADH, HBDH, Oxidoreductase
Deposited on 2008-10-07, released 2009-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D(-)-3-hydroxybutyrate dehydrogenase
    Species: Pseudomonas fragi [TaxId:296]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ztla_
  • Chain 'B':
    Compound: D(-)-3-hydroxybutyrate dehydrogenase
    Species: Pseudomonas fragi [TaxId:296]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ztlb_
  • Chain 'C':
    Compound: D(-)-3-hydroxybutyrate dehydrogenase
    Species: Pseudomonas fragi [TaxId:296]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ztlc_
  • Chain 'D':
    Compound: D(-)-3-hydroxybutyrate dehydrogenase
    Species: Pseudomonas fragi [TaxId:296]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ztld_
  • Heterogens: NAD, 3HL, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ztlA (A:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvrtplvekqisalaekngvdqetaarellsekqpslqfvtpeqlggtavflas
    daaaqitgttvsvdggwtar
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ztlB (B:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvrtplvekqisalaekngvdqetaarellsekqpslqfvtpeqlggtavflas
    daaaqitgttvsvdggwtar
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ztlC (C:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvrtplvekqisalaekngvdqetaarellsekqpslqfvtpeqlggtavflas
    daaaqitgttvsvdggwtar
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ztlD (D:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvrtplvekqisalaekngvdqetaarellsekqpslqfvtpeqlggtavflas
    daaaqitgttvsvdggwtar