PDB entry 2zth

View 2zth on RCSB PDB site
Description: Crystal structure of holo form of rat catechol-o-methyltransferase
Class: transferase
Keywords: S-Adenosylmethionine dependent methyltransferase, Alternative initiation, Catecholamine metabolism, Cell membrane, Cytoplasm, Magnesium, Membrane, Metal-binding, Methyltransferase, Neurotransmitter degradation, Phosphoprotein, S-adenosyl-L-methionine, Signal-anchor, Transferase, Transmembrane
Deposited on 2008-10-01, released 2009-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.196
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catechol O-methyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: liver
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ztha_
  • Heterogens: MG, SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zthA (A:)
    gsmgdtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireys
    pslvlelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilnga
    sqdlipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpd
    flayvrgsssfecthyssyleymkvvdglekaiyqgpsspdks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zthA (A:)
    dtkeqrilryvqqnakpgdpqsvleaidtyctqvgdakgqimdavireyspslvlelgay
    cgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqdlipqlkk
    kydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflayvrgsss
    fecthyssyleymkvvdglekaiyqg