PDB entry 2zt2

View 2zt2 on RCSB PDB site
Description: Carbonmonoxy Sperm Whale Myoglobin at 120 K: Laser on [600 min]
Class: oxygen transport
Keywords: haem protein, myoglobin, ligand migration, photodissociation, Heme, Iron, Metal-binding, Muscle protein, Oxygen transport, Transport
Deposited on 2008-09-18, released 2009-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-152)
  Domains in SCOPe 2.07: d2zt2a_
• Heterogens: HEM, CMO, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2zt2A (A:)
  vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
  lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
  gdfgadaqgamnkalelfrkdiaakykelgyqg