PDB entry 2zsw

View 2zsw on RCSB PDB site
Description: Crystal structure of H-2Kb in complex with the Q600Y variant of JHMV epitope S598
Class: immune system
Keywords: Ig Fold, protein-protein interactions, Immune System, subdominant epitope,Glycoprotein, Immune response, Membrane, MHC I, Transmembrane, Immunoglobulin domain, Secreted
Deposited on 2008-09-18, released 2008-11-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.214
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: h-2 class I histocompatibility antigen, k-b alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-K1, H2-K
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2zswb_
  • Chain 'C':
    Compound: h-2 class I histocompatibility antigen, k-b alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-K1, H2-K
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2zswd_
  • Chain 'E':
    Compound: h-2 class I histocompatibility antigen, k-b alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-K1, H2-K
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2zswf_
  • Chain 'G':
    Compound: h-2 class I histocompatibility antigen, k-b alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-K1, H2-K
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2zswh_
  • Chain 'M':
    Compound: 8-mer peptide from spike glycoprotein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZSW (0-7)
  • Chain 'N':
    Compound: 8-mer peptide from spike glycoprotein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZSW (0-7)
  • Chain 'O':
    Compound: 8-mer peptide from spike glycoprotein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZSW (0-7)
  • Chain 'P':
    Compound: 8-mer peptide from spike glycoprotein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZSW (0-7)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2zswB (B:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

    Sequence, based on observed residues (ATOM records): (download) 
    >2zswB (B:)
qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws
fyilahteftptetdtyacrvkhdsmaepktvywdrdm

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >2zswD (D:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

    Sequence, based on observed residues (ATOM records): (download) 
    >2zswD (D:)
qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws
fyilahteftptetdtyacrvkhdsmaepktvywdrdm

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download) 
    >2zswF (F:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

    Sequence, based on observed residues (ATOM records): (download) 
    >2zswF (F:)
qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws
fyilahteftptetdtyacrvkhdsmaepktvywdrdm

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download) 
    >2zswH (H:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

    Sequence, based on observed residues (ATOM records): (download) 
    >2zswH (H:)
qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws
fyilahteftptetdtyacrvkhdsmaepktvywdrdm

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.