PDB entry 2zsw
View 2zsw on RCSB PDB site
Description: Crystal structure of H-2Kb in complex with the Q600Y variant of JHMV epitope S598
Class: immune system
Keywords: Ig Fold, protein-protein interactions, Immune System, subdominant epitope,Glycoprotein, Immune response, Membrane, MHC I, Transmembrane, Immunoglobulin domain, Secreted
Deposited on
2008-09-18, released
2008-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.214
AEROSPACI score: 0.26
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: h-2 class I histocompatibility antigen, k-b alpha chain
Species: Mus musculus [TaxId:10090]
Gene: H2-K1, H2-K
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Beta-2-microglobulin
Species: Mus musculus [TaxId:10090]
Gene: B2M
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2zswb_ - Chain 'C':
Compound: h-2 class I histocompatibility antigen, k-b alpha chain
Species: Mus musculus [TaxId:10090]
Gene: H2-K1, H2-K
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Beta-2-microglobulin
Species: Mus musculus [TaxId:10090]
Gene: B2M
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2zswd_ - Chain 'E':
Compound: h-2 class I histocompatibility antigen, k-b alpha chain
Species: Mus musculus [TaxId:10090]
Gene: H2-K1, H2-K
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: Beta-2-microglobulin
Species: Mus musculus [TaxId:10090]
Gene: B2M
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2zswf_ - Chain 'G':
Compound: h-2 class I histocompatibility antigen, k-b alpha chain
Species: Mus musculus [TaxId:10090]
Gene: H2-K1, H2-K
Database cross-references and differences (RAF-indexed):
- Chain 'H':
Compound: Beta-2-microglobulin
Species: Mus musculus [TaxId:10090]
Gene: B2M
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2zswh_ - Chain 'M':
Compound: 8-mer peptide from spike glycoprotein
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'N':
Compound: 8-mer peptide from spike glycoprotein
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'O':
Compound: 8-mer peptide from spike glycoprotein
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'P':
Compound: 8-mer peptide from spike glycoprotein
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence, based on SEQRES records: (download)
>2zswB (B:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Sequence, based on observed residues (ATOM records): (download)
>2zswB (B:)
qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws
fyilahteftptetdtyacrvkhdsmaepktvywdrdm
- Chain 'C':
No sequence available.
- Chain 'D':
Sequence, based on SEQRES records: (download)
>2zswD (D:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Sequence, based on observed residues (ATOM records): (download)
>2zswD (D:)
qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws
fyilahteftptetdtyacrvkhdsmaepktvywdrdm
- Chain 'E':
No sequence available.
- Chain 'F':
Sequence, based on SEQRES records: (download)
>2zswF (F:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Sequence, based on observed residues (ATOM records): (download)
>2zswF (F:)
qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws
fyilahteftptetdtyacrvkhdsmaepktvywdrdm
- Chain 'G':
No sequence available.
- Chain 'H':
Sequence, based on SEQRES records: (download)
>2zswH (H:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Sequence, based on observed residues (ATOM records): (download)
>2zswH (H:)
qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws
fyilahteftptetdtyacrvkhdsmaepktvywdrdm
- Chain 'M':
No sequence available.
- Chain 'N':
No sequence available.
- Chain 'O':
No sequence available.
- Chain 'P':
No sequence available.