PDB entry 2zso

View 2zso on RCSB PDB site
Description: Carbonmonoxy Sperm Whale Myoglobin at 100 K: Laser on [450 min]
Class: oxygen transport
Keywords: haem protein, myoglobin, ligand migration, photodissociation, Heme, Iron, Metal-binding, Muscle protein, Oxygen transport, Transport
Deposited on 2008-09-17, released 2009-02-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2zsoa_
  • Heterogens: HEM, CMO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zsoA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg