PDB entry 2zs1

View 2zs1 on RCSB PDB site
Description: Structural Basis for the Heterotropic and Homotropic Interactions of Invertebrate Giant Hemoglobin
Class: Oxygen Storage, Oxygen transport
Keywords: hemoglobin, annelida, magnesium, cooperativity, Heme, Iron, Metal-binding, Oxygen transport, Secreted, Transport, Oxygen Storage
Deposited on 2008-09-02, released 2008-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Extracellular giant hemoglobin major globin subunit A1
    Species: Oligobrachia mashikoi [TaxId:55676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zs1a_
  • Chain 'B':
    Compound: Extracellular giant hemoglobin major globin subunit A2
    Species: Oligobrachia mashikoi [TaxId:55676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zs1b_
  • Chain 'C':
    Compound: Extracellular giant hemoglobin major globin subunit B2
    Species: Oligobrachia mashikoi [TaxId:55676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zs1c_
  • Chain 'D':
    Compound: Extracellular giant hemoglobin major globin subunit B1
    Species: Oligobrachia mashikoi [TaxId:55676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5KSB7 (0-144)
      • microheterogeneity (30)
      • microheterogeneity (37)
      • microheterogeneity (40)
      • microheterogeneity (56-58)
      • microheterogeneity (68)
      • microheterogeneity (96)
      • microheterogeneity (111)
      • microheterogeneity (130)
    Domains in SCOPe 2.07: d2zs1d_
  • Heterogens: HEM, OXY, GOL, CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zs1A (A:)
    vcnrleqilvktqwaqsygeaenraafsrdlfselfniqgssralfsgvgvddmnsaaft
    ahclrvtgalnrlisqldqqatinadlahlagqhasrnldasnfaamgqavmsvvpthld
    cfnqhawgecyeriasgisg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zs1B (B:)
    dctslnrllvkrqwaeaygegtnrellgnriwedlfanmpdarglfsrvngndidssefq
    ahslrvlggldmcvaslddvpvlnallarlnsqhdsrgipaagypafvasaisavratvg
    arsfdndawnscmnqivsgisg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zs1C (C:)
    ssccssedranvmhnwdaawsaaysdrrvalaqavfaslfsrdaaaqglfsgvsadnpds
    adfrahcvrvvngldvainmlndpavlneqlahlsaqhqaragvaaahfdvmaeafaevm
    pqvsscfssdswnrcfariangisagl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zs1D (D:)
    eccsrgdaevvisewdqvfnaamagssesaigvaifdvfftssgvspsmfpgggdsssae
    flaqvsrvisgadiainsltnratcdsllshlnaqhkaisgvtgaavthlseaissvvaq
    vlpsahidawgycmayiaagigagl