PDB entry 2zrm

View 2zrm on RCSB PDB site
Description: MsRecA dATP form IV
Class: hydrolase
Keywords: recombination, RecA mutants, DNA-REPAIR, ATP-binding, DNA damage, DNA recombination, DNA repair, DNA-binding, Nucleotide-binding, SOS response, HYDROLASE
Deposited on 2008-08-27, released 2008-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.215
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein recA
    Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zrma1, d2zrma2
  • Heterogens: DTP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zrmA (A:)
    maqqapdrekalelamaqidknfgkgsvmrlgeevrqpisviptgsisldvalgigglpr
    grvieiygpessgkttvalhavanaqaaggiaafidaehaldpeyakklgvdtdsllvsq
    pdtgeqaleiadmlvrsgaldiividsvaalvpraeiegemgdshvglqarlmsqalrkm
    tgalnnsgttaifinqlrekigvmfgspetttggkalkfyasvrldvrrietlkdgtdav
    gnrtrvkvvknkvsppfkqaefdilygqgisregslidmgvehgfirksgswftyegeql
    gqgkenarkfllentdvaneiekkikeklgigavvtaeaddvlpapvdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zrmA (A:)
    pdrekalelamaqidknfgkgsvmrlgeevrqpisviptgsisldvalgigglprgrvie
    iygpessgkttvalhavanaqaaggiaafidaehaldpeyakklgvdtdsllvsqpdtge
    qaleiadmlvrsgaldiividsvaalvpraeiegemgdshvglqarlmsqalrkmtgaln
    nsgttaifinqlretttggkalkfyasvrldvrrietlkdgtdavgnrtrvkvvknkvsp
    pfkqaefdilygqgisregslidmgvehgfirksgswftyegeqlgqgkenarkfllent
    dvaneiekkikeklgigav