PDB entry 2zqz

View 2zqz on RCSB PDB site
Description: R-state structure of allosteric L-lactate dehydrogenase from Lactobacillus casei
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, Rossmann fold, Cytoplasm, Glycolysis, NAD, Phosphoprotein
Deposited on 2008-08-22, released 2009-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-02-09, with a file datestamp of 2010-02-05.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.212
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: LDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zqza1, d2zqza2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: LDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zqzb1, d2zqzb2
  • Chain 'C':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: LDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zqzc1, d2zqzc2
  • Chain 'D':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: LDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zqzd1, d2zqzd2
  • Chain 'E':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: LDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zqze1, d2zqze2
  • Chain 'F':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: LDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zqzf1, d2zqzf2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zqzA (A:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqzA (A:)
    dkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkk
    iysaeysdakdadlvvitagaptrldlvnknlkilksivdpivdsgfngiflvaanpvdi
    ltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimgehgdtefpvws
    haniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygiatalariskai
    lndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmqksasqlk
    kvltdaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zqzB (B:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqzB (B:)
    dkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkk
    iysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflvaa
    npvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimgehgdte
    fpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygiatalar
    iskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmqks
    asqlkkvltdafa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zqzC (C:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqzC (C:)
    dkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkk
    iysaeysdakdadlvvitvnknlkilksivdpivdsgfngiflvaanpvdiltyatwkls
    gfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimgehgdtefpvwshaniggvti
    aewvkahpeikedklvkmfedvrdaayeiiklkgatfygiatalariskailndenavlp
    lsvymdgqyglndiyigtpavinrngiqnileipltdheeesmqksasqlkkvltda
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2zqzD (D:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqzD (D:)
    dkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkk
    iysaeysdakdadlvvitagaptrldlvnknlkilksivdpivdsgfngiflvaanpvdi
    ltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimgehgdtefpvws
    haniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygiatalariskai
    lndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmqksasqlk
    kvltdaf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2zqzE (E:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqzE (E:)
    dkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkk
    iysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflvaa
    npvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimgehgdte
    fpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygiatalar
    iskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmqks
    asqlkkvltdaf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2zqzF (F:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqzF (F:)
    dkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkk
    iysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflvaa
    npvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimgehgdte
    fpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygiatalar
    iskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmqks
    asqlkkvltdafa