PDB entry 2zqt

View 2zqt on RCSB PDB site
Description: Crystal structure of a mutant PIN1 PEPTIDYL-PROLYL CIS-TRANS ISOMERASE
Class: isomerase
Keywords: PIN1 mutant M130A, Cell cycle, Isomerase, Nucleus, Phosphoprotein, Rotamase
Deposited on 2008-08-19, released 2009-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.244
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13526 (Start-162)
      • engineered (129)
    Domains in SCOPe 2.07: d2zqta1, d2zqta2
  • Heterogens: SO4, 1PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zqtA (A:)
    madeeklppgwekrmsrssgrvyyfnhitnasqwerpsgnsssggkngqgeparvrcshl
    lvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqfsdcssakarg
    dlgafsrgqaqkpfedasfalrtgemsgpvftdsgihiilrte
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqtA (A:)
    klppgwekrmsrssgrvyyfnhitnasqwerpsggkngqgeparvrcshllvkhsqsrrp
    sswrqekitrtkeealelingyiqkiksgeedfeslasqfsdcssakargdlgafsrgqa
    qkpfedasfalrtgemsgpvftdsgihiilrte